DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and AtMYB103

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_176575.1 Gene:AtMYB103 / 842694 AraportID:AT1G63910 Length:370 Species:Arabidopsis thaliana


Alignment Length:141 Identity:48/141 - (34%)
Similarity:81/141 - (57%) Gaps:7/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NPELIK-GPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTE 193
            |.:.:| |.|:.:||:.:|:.:...|...|:.:..... .|.||.||.||.|:|.|:|::..::.
plant     8 NQQKVKRGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYLRPDIRRGRFSP 72

  Fly   194 KEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRK-----YDVERRSVNASGSDLKS 253
            :|:::|...|..:||:||.||..|||||||.|||:|||.:::|     :...|...:.:...|.:
plant    73 EEEKLIISLHGVVGNRWAHIASHLPGRTDNEIKNYWNSWIKKKIRKPHHHYSRHQPSVTTVTLNA 137

  Fly   254 SRTHLITLIKS 264
            ..|.:.|.|::
plant   138 DTTSIATTIEA 148

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity