DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and AT1G43330

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_175020.1 Gene:AT1G43330 / 840934 AraportID:AT1G43330 Length:118 Species:Arabidopsis thaliana


Alignment Length:76 Identity:24/76 - (31%)
Similarity:38/76 - (50%) Gaps:12/76 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SEDVLLKQLVETHGENWEIIGPHF------------KDRLEQQVQQRWAKVLNPELIKGPWTRDE 143
            :|.:.|.:|......|.:.:.|.|            ..|.:.|.|.||.|||:|.|.||.|.::|
plant     2 TESIDLNRLESESDNNTDDVTPIFAIDDSAKGYFSLNRRNDVQCQHRWLKVLDPSLQKGAWKKEE 66

  Fly   144 DDMVIKLVRNF 154
            |.::.:||:|:
plant    67 DKLLSELVKNY 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 21/67 (31%)
PLN03212 136..>236 CDD:178751 8/19 (42%)
Cmyb_C 388..>484 CDD:462753
AT1G43330NP_175020.1 SANT <37..70 CDD:473887 15/32 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.