DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB93

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_174726.1 Gene:MYB93 / 840371 AraportID:AT1G34670 Length:365 Species:Arabidopsis thaliana


Alignment Length:348 Identity:89/348 - (25%)
Similarity:141/348 - (40%) Gaps:70/348 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEKEDE 197
            |.|||||.:||..:|..:...|...|..:.:..: .|.||.||.||.|:|.|:||:..::.:|::
plant    12 LKKGPWTPEEDQKLIDYIHKHGHGSWRALPKLADLNRCGKSCRLRWTNYLRPDIKRGKFSAEEEQ 76

  Fly   198 IIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSV----NASGSDLKSSRTHL 258
            .|...|..|||:|:.||..|.|||||.|||.||:.:::|  :.:..:    :...:||.:|...|
plant    77 TILHLHSILGNKWSAIATHLQGRTDNEIKNFWNTHLKKK--LIQMGIDPVTHQPRTDLFASLPQL 139

  Fly   259 ITLIKSGGISKCMNNMQHNKESGGEA--------VNKSENADGASVTAVKGGDLAQES--QDDHQ 313
            |.|   ..:...:..........|||        :.:..|: .||:|...|.:.:..|  ..|..
plant   140 IAL---ANLKDLIEQTSQFSSMQGEAAQLANLQYLQRMFNS-SASLTNNNGNNFSPSSILDIDQH 200

  Fly   314 KGSNLAHLSMQHLIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETF--------------NQE 364
            ...||.: ||....|...|...|::           ..:|...:.:.|              .|:
plant   201 HAMNLLN-SMVSWNKDQNPAFDPVL-----------ELEANDQNQDLFPLGFIIDQPTQPLQQQK 253

  Fly   365 EAAGNARSRPPS--SPVISPIKSLPF-------SPSHFL----KSPCLTTFEDMDLRASTPVTKV 416
            ....|:.|..||  .|::..:   ||       |..||:    |.|.....|..|..:|..:..:
plant   254 YHLNNSPSELPSQGDPLLDHV---PFSLQTPLNSEDHFIDNLVKHPTDHEHEHDDNPSSWVLPSL 315

  Fly   417 YNRVGMEIKKEMETSSIETPHKS 439
                   |....:|.:...||.:
plant   316 -------IDNNPKTVTSSLPHNN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 8/12 (67%)
SANT 136..184 CDD:197842 19/48 (40%)
Myb_DNA-bind_6 139..197 CDD:290632 20/58 (34%)
SANT 188..235 CDD:197842 20/46 (43%)
Myb_DNA-binding 188..233 CDD:278669 20/44 (45%)
Cmyb_C 388..530 CDD:286408 13/63 (21%)
MYB93NP_174726.1 PLN03091 1..>195 CDD:215570 59/188 (31%)
Med3 <151..265 CDD:371616 22/126 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.