DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB117

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001154369.1 Gene:MYB117 / 839219 AraportID:AT1G26780 Length:359 Species:Arabidopsis thaliana


Alignment Length:236 Identity:79/236 - (33%)
Similarity:103/236 - (43%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DTQVCDKDSQQN----SNADSGYPLDSPELQDSKTTGQKGQNKSGKTSI-GAVHPNYGFGKRWSK 90
            |..|.:::|..|    ||::||    ..|..||   ||...:.|.|.|: |..|        |..
plant    54 DVAVHEEESNNNNPNFSNSESG----KKETTDS---GQSWSSSSSKPSVLGRGH--------WRP 103

  Fly    91 SEDVLLKQLVETHGENWEIIGPHFKDRLEQQVQQRWAKVLNPELIKGPWTRDEDDMVIKLVRNFG 155
            :|||.||:||..                                                   :|
plant   104 AEDVKLKELVSI---------------------------------------------------YG 117

  Fly   156 PKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGR 220
            |:.|.|||..|.||.||.||.||.|.|:|.|.:.|:||:|:|.:.|||...||:||.||:..|||
plant   118 PQNWNLIAEKLQGRSGKSCRLRWFNQLDPRINRRAFTEEEEERLMQAHRLYGNKWAMIARLFPGR 182

  Fly   221 TDNAIKNHWNSTMRRKY----DVERRSVNASGSDLKSSRTH 257
            |||::||||:..|.|||    ...||....|.:.||...|:
plant   183 TDNSVKNHWHVVMARKYREHSSAYRRRKLMSNNPLKPHLTN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 8/46 (17%)
Myb_DNA-bind_6 88..147 CDD:290632 8/58 (14%)
SANT 136..184 CDD:197842 17/47 (36%)
Myb_DNA-bind_6 139..197 CDD:290632 23/57 (40%)
SANT 188..235 CDD:197842 25/46 (54%)
Myb_DNA-binding 188..233 CDD:278669 24/44 (55%)
Cmyb_C 388..530 CDD:286408
MYB117NP_001154369.1 PLN03091 96..>201 CDD:215570 57/163 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45614
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.