| Sequence 1: | NP_511170.1 | Gene: | Myb / 32543 | FlyBaseID: | FBgn0002914 | Length: | 657 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_173306.1 | Gene: | MYB47 / 838453 | AraportID: | AT1G18710 | Length: | 267 | Species: | Arabidopsis thaliana |
| Alignment Length: | 196 | Identity: | 59/196 - (30%) |
|---|---|---|---|
| Similarity: | 99/196 - (50%) | Gaps: | 19/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 136 KGPWTRDEDDMVIKLVRNFGPKKW-TLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEII 199
Fly 200 YQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYD------------VERRSVNASGSDLK 252
Fly 253 SSRT----HLITLIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQ 313
Fly 314 K 314 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Myb | NP_511170.1 | SANT | 85..132 | CDD:197842 | |
| Myb_DNA-bind_6 | 88..147 | CDD:290632 | 6/10 (60%) | ||
| SANT | 136..184 | CDD:197842 | 19/48 (40%) | ||
| Myb_DNA-bind_6 | 139..197 | CDD:290632 | 21/58 (36%) | ||
| SANT | 188..235 | CDD:197842 | 24/46 (52%) | ||
| Myb_DNA-binding | 188..233 | CDD:278669 | 24/44 (55%) | ||
| Cmyb_C | 388..530 | CDD:286408 | |||
| MYB47 | NP_173306.1 | SANT | 14..63 | CDD:197842 | 19/48 (40%) |
| Myb_DNA-binding | 14..61 | CDD:278669 | 18/46 (39%) | ||
| SANT | 67..114 | CDD:197842 | 24/46 (52%) | ||
| Myb_DNA-binding | 67..112 | CDD:278669 | 24/44 (55%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5147 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||