DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB51

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_173292.1 Gene:MYB51 / 838438 AraportID:AT1G18570 Length:352 Species:Arabidopsis thaliana


Alignment Length:327 Identity:83/327 - (25%)
Similarity:132/327 - (40%) Gaps:68/327 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKW-TLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDE 197
            |.||.||.:||..::..:...|...| ||..:....|.||.||.||.|:|.|:||:..:||.|:.
plant    13 LKKGAWTPEEDQKLLSYLNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYLRPDIKRGEFTEDEER 77

  Fly   198 IIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLI 262
            .|...|...||:|:.||:.|||||||.|||:||:.::::                        ||
plant    78 SIISLHALHGNKWSAIARGLPGRTDNEIKNYWNTHIKKR------------------------LI 118

  Fly   263 KSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQHLI 327
            |.|     ::.:.|...:.|  .:||||........:...|...::....:...|....|...|.
plant   119 KKG-----IDPVTHKGITSG--TDKSENLPEKQNVNLTTSDHDLDNDKAKKNNKNFGLSSASFLN 176

  Fly   328 KLTMPRQTPIILKRTRKHIPE----------------THHQAGCSSSETFNQEEAAGNARSRPPS 376
            |         :..|..|.|.:                :|.....::|.:.:.|.....:.|..|:
plant   177 K---------VANRFGKRINQSVLSEIIGSGGPLASTSHTTNTTTTSVSVDSESVKSTSSSFAPT 232

  Fly   377 SPVI--SPIKSLPFSPSHF-----LKSPC-LTTFEDMDLRASTPVTKVYNRVGMEIKKEMETSSI 433
            |.::  ..:.:.|.| |:|     :...| .:||.|..:  :.|:....|.||.....:.:|...
plant   233 SNLLCHGTVATTPVS-SNFDVDGNVNLTCSSSTFSDSSV--NNPLMYCDNFVGNNNVDDEDTIGF 294

  Fly   434 ET 435
            .|
plant   295 ST 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 7/12 (58%)
SANT 136..184 CDD:197842 19/48 (40%)
Myb_DNA-bind_6 139..197 CDD:290632 23/58 (40%)
SANT 188..235 CDD:197842 22/46 (48%)
Myb_DNA-binding 188..233 CDD:278669 22/44 (50%)
Cmyb_C 388..530 CDD:286408 13/54 (24%)
MYB51NP_173292.1 PLN03091 1..>155 CDD:215570 56/172 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.