DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and FLP

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001077534.1 Gene:FLP / 837997 AraportID:AT1G14350 Length:436 Species:Arabidopsis thaliana


Alignment Length:598 Identity:115/598 - (19%)
Similarity:198/598 - (33%) Gaps:198/598 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LQDSKTTGQKGQNKSGKTSIGAVHPNYGFGKRWSKSEDVLLKQLVETHG-ENWEIIGPHFKDRLE 119
            ::|:|...:|..|.:..:.....|.     ..||:.|||:|::.:..|| |||.||...|||:..
plant     1 MEDTKKKKKKNINNNQDSKKKERHI-----VTWSQEEDVILREQITLHGTENWAIIASKFKDKST 60

  Fly   120 QQVQQRWAKVLNPELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNP 184
                                                                :|||.||:.:||.
plant    61 ----------------------------------------------------RQCRRRWYTYLNS 73

  Fly   185 NIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGS 249
            :.|:..|:.:||.::.:|....||:|.:|||.:.||||||:||.:.:.                 
plant    74 DFKRGGWSPEEDMLLCEAQRVFGNRWTEIAKVVSGRTDNAVKNRFTTL----------------- 121

  Fly   250 DLKSSRTHLITLIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQK 314
                                |....:|      ||:.|..|::...:..:.|....::|::    
plant   122 --------------------CKKRAKH------EAMTKDSNSNTKRMLFLDGISTPRKSEN---- 156

  Fly   315 GSNLAHLSMQHLIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPSSPV 379
                               :|||..|..|.||.:      .:....:.:.||..|.:.|.|.|.:
plant   157 -------------------ETPIAKKLKRSHILD------LTEISNYGRAEACVNQQIRSPFSVL 196

  Fly   380 ---ISPIKSL-----------PFSPSHFLKSPCLTTFEDMDLRASTPVTKVYNRVGMEIKKEMET 430
               .:.|.||           ......|||.      :|..:.|.....::.:.:..::..:...
plant   197 ARNATGIDSLEEQNQTSNVNESDGEGMFLKK------DDPKVTALMQQAELLSSLAQKVNADNTE 255

  Fly   431 SSIETPHKSQLGPRTPTPFKKALAAIGKKRDGRRYEPSSPSSLVEDLAEIIHEEHLSNSLTANNS 495
            .|:|...|          ..:.....||:.|..||........:|:..::|  |.|.:....|..
plant   256 QSMENAWK----------VLQDFLNKGKENDLFRYGIPDIDFKIEEFKDLI--EDLRSGYEDNQL 308

  Fly   496 KMMGAADQNSTLSTEYNAQSPPHMKRARKSLLSTWSSNHPYNAGSAKRIQPFETETPSKFLTSPG 560
            ........:|..|:||::.|...:.:                  |..:.|||..:|.::. ...|
plant   309 SWRQPDLHDSPASSEYSSGSTIMVDQ------------------SGDKTQPFSADTQTEH-KQVG 354

  Fly   561 DILKDTLCSEQDLPFDEGRKENRPFHNRRINKYRGGLTYDHVIDPKWARVACGKSRDQMFMEEQA 625
            :.|......::::|.....|.:.|..                :.|.:..:|.|....| |.|.:.
plant   355 EELLVPKNPDENMPISGEEKFSSPIQ----------------VTPLFRSLADGIPSPQ-FSESER 402

  Fly   626 YACLKNLSCISRS 638
            ...||.|...|.|
plant   403 SFLLKTLGIESSS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 16/47 (34%)
Myb_DNA-bind_6 88..147 CDD:290632 16/59 (27%)
SANT 136..184 CDD:197842 6/47 (13%)
Myb_DNA-bind_6 139..197 CDD:290632 10/57 (18%)
SANT 188..235 CDD:197842 18/46 (39%)
Myb_DNA-binding 188..233 CDD:278669 18/44 (41%)
Cmyb_C 388..530 CDD:286408 23/141 (16%)
FLPNP_001077534.1 PLN03091 28..>223 CDD:215570 66/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.