DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB60

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_172358.1 Gene:MYB60 / 837403 AraportID:AT1G08810 Length:280 Species:Arabidopsis thaliana


Alignment Length:268 Identity:75/268 - (27%)
Similarity:109/268 - (40%) Gaps:77/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKEDEI 198
            |||||.:||.:::..::..||..|..:... .|  |..|.||.||.|:|.|.||:..:|..|:.:
plant    14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTN-TGLLRCSKSCRLRWTNYLRPGIKRGNFTPHEEGM 77

  Fly   199 IYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKY-----DVERRSVNAS--GSDLKSSRT 256
            |......|||:||.||..||.||||.|||:||:.:::|.     |...||.|.:  .|..:::..
plant    78 IIHLQALLGNKWASIASYLPQRTDNDIKNYWNTHLKKKLNKSDSDERSRSENIALQTSSTRNTIN 142

  Fly   257 HLITLIKS-GGISKCM------------------NNMQ--------------------------H 276
            |..|...| ..||:.:                  :.||                          |
plant   143 HRSTYASSTENISRLLEGWMRASPKSSTSTTFLEHKMQNRTNNFIDHHSDQFPYEQLQGSWEEGH 207

  Fly   277 NKESGG---EAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHL----------------S 322
            :|...|   :.:..|||.:|..|.. :.||  .|..|||.....|..:                .
plant   208 SKGINGDDDQGIKNSENNNGDDVHH-EDGD--HEDDDDHNATPPLTFIEKWLLEETSTTGGQMEE 269

  Fly   323 MQHLIKLT 330
            |.||::|:
plant   270 MSHLMELS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 7/10 (70%)
SANT 136..184 CDD:197842 19/49 (39%)
Myb_DNA-bind_6 139..197 CDD:290632 21/59 (36%)
SANT 188..235 CDD:197842 21/46 (46%)
Myb_DNA-binding 188..233 CDD:278669 21/44 (48%)
Cmyb_C 388..530 CDD:286408
MYB60NP_172358.1 PLN03212 5..>125 CDD:178751 45/111 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.