DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB13

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_172108.1 Gene:MYB13 / 837127 AraportID:AT1G06180 Length:246 Species:Arabidopsis thaliana


Alignment Length:224 Identity:65/224 - (29%)
Similarity:106/224 - (47%) Gaps:41/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKED 196
            |.||||:.:||.::|..:...|...|..:.: |.|  |.||.||.||.|:|.|:||:..:|..|:
plant    12 LKKGPWSAEEDRILINYISLHGHPNWRALPK-LAGLLRCGKSCRLRWINYLRPDIKRGNFTPHEE 75

  Fly   197 EIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRK----YDVERRS--VNASGSDL---- 251
            :.|...|..|||:|:.||.:|||||||.|||.|::.::::    .|...:.  |:.:.:::    
plant    76 DTIISLHQLLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLHHSQDQNNKEDFVSTTAAEMPTSP 140

  Fly   252 --KSSRTHLITLIKSGGISKCMNNMQHNKESGGEAV--------------------------NKS 288
              :||.:..|:.|.:.|.:..::|...:..:..|.|                          .|.
plant   141 QQQSSSSADISAITTLGNNNDISNSNKDSATSSEDVLAIIDESFWSEVVLMDCDISGNEKNEKKI 205

  Fly   289 ENADGASVTAVKGGDLAQESQDDHQKGSN 317
            ||.:|:.....||.:...|...||...|:
plant   206 ENWEGSLDRNDKGYNHDMEFWFDHLTSSS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 7/12 (58%)
PLN03212 136..>236 CDD:178751 44/101 (44%)
Cmyb_C 388..>484 CDD:462753
MYB13NP_172108.1 PLN03091 1..>116 CDD:215570 45/104 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.