DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB99

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_201038.1 Gene:MYB99 / 836353 AraportID:AT5G62320 Length:245 Species:Arabidopsis thaliana


Alignment Length:209 Identity:69/209 - (33%)
Similarity:99/209 - (47%) Gaps:49/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFG--------------PKKWTLIARYLNG--RIGKQCRERWHNHL 182
            |.|||||.:||..::..:|..|              ||        |.|  |.||.||.||.|:|
plant    13 LRKGPWTVEEDGKLVDFLRARGNCGGGGGGWCWRDVPK--------LAGLRRCGKSCRLRWTNYL 69

  Fly   183 NPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKY-------DVE 240
            .|::|:..:||:|.:::...|..|||:|:|||..|||||||.|||:||:.::||.       :..
plant    70 RPDLKRGLFTEEEIQLVIDLHARLGNRWSKIAVELPGRTDNDIKNYWNTHIKRKLIRMGIDPNTH 134

  Fly   241 RR----SVNASGSDLKS-----SRTHLITLIKSGGISKCMNNMQHNKESGGEAVNKS---ENADG 293
            ||    .||...:.|.:     |.|.:...:|:...:....|:....:..|:....|   ||.:|
plant   135 RRFDQQKVNEEETILVNDPKPLSETEVSVALKNDTSAVLSGNLNQLADVDGDDQPWSFLMENDEG 199

  Fly   294 ASVTAVKGGDLAQE 307
            .      |||.|.|
plant   200 G------GGDAAGE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 8/12 (67%)
SANT 136..184 CDD:197842 22/63 (35%)
Myb_DNA-bind_6 139..197 CDD:290632 24/73 (33%)
SANT 188..235 CDD:197842 23/46 (50%)
Myb_DNA-binding 188..233 CDD:278669 23/44 (52%)
Cmyb_C 388..530 CDD:286408
MYB99NP_201038.1 PLN03091 3..>180 CDD:215570 59/174 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.