DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB82

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_680426.1 Gene:MYB82 / 835337 AraportID:AT5G52600 Length:201 Species:Arabidopsis thaliana


Alignment Length:161 Identity:54/161 - (33%)
Similarity:74/161 - (45%) Gaps:52/161 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 WSKSEDVLLKQLVETHGE-NWEIIGPHFKDRLEQQVQQRWAKVLNPELIKGPWTRDEDDMVIKLV 151
            |...||::||..|||||| ||..|.                                        
plant    17 WKPEEDMILKSYVETHGEGNWADIS---------------------------------------- 41

  Fly   152 RNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKR 216
            |..|.|           |.||.||.||.|:|.||||:.:.:.:|.::|.:.|..|||:|:.||.|
plant    42 RRSGLK-----------RGGKSCRLRWKNYLRPNIKRGSMSPQEQDLIIRMHKLLGNRWSLIAGR 95

  Fly   217 LPGRTDNAIKNHWNSTMRRKYDVERRSVNAS 247
            |||||||.:||:||:.:.:|.:..|::...|
plant    96 LPGRTDNEVKNYWNTHLNKKPNSRRQNAPES 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 14/44 (32%)
Myb_DNA-bind_6 88..147 CDD:290632 14/59 (24%)
SANT 136..184 CDD:197842 12/47 (26%)
Myb_DNA-bind_6 139..197 CDD:290632 17/57 (30%)
SANT 188..235 CDD:197842 21/46 (46%)
Myb_DNA-binding 188..233 CDD:278669 21/44 (48%)
Cmyb_C 388..530 CDD:286408
MYB82NP_680426.1 SANT 14..63 CDD:197842 26/96 (27%)
Myb_DNA-binding 14..61 CDD:278669 25/94 (27%)
SANT 67..114 CDD:197842 21/46 (46%)
Myb_DNA-binding 67..112 CDD:278669 21/44 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.