DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB22

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_568582.1 Gene:MYB22 / 834041 AraportID:AT5G40430 Length:256 Species:Arabidopsis thaliana


Alignment Length:173 Identity:68/173 - (39%)
Similarity:102/173 - (58%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KDRLEQQVQQRWAKVL-NPELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERW 178
            |...|.:.:...:|.| ..::.|..||..||..:.::|. ..|||||.:|::..||..|||||||
plant    32 KKTYENKKEASTSKYLKKSDITKKRWTESEDIKLKEMVA-LEPKKWTKVAKHFEGRTPKQCRERW 95

  Fly   179 HNHLNPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRS 243
            |||..||:|||.|:|:||:|:.:.|..:|.:|.:|:::||||:.|.:|||||:|.||..:...|:
plant    96 HNHARPNVKKTTWSEEEDQILIEVHKVIGAKWIQISEQLPGRSYNNVKNHWNTTKRRVQNKSGRT 160

  Fly   244 VNASGSDLKSSRTHLITLIKSGGISKCMNNMQHNKESGGEAVN 286
            ||..|:::..:....||:          ||   :.||.||..|
plant   161 VNRVGNNILENYIRSITI----------NN---DDESDGEPTN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 9/32 (28%)
PLN03212 136..>236 CDD:178751 50/99 (51%)
Cmyb_C 388..>484 CDD:462753
MYB22NP_568582.1 PLN03091 49..>148 CDD:215570 47/99 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.