DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB115

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_568581.1 Gene:MYB115 / 834034 AraportID:AT5G40360 Length:359 Species:Arabidopsis thaliana


Alignment Length:353 Identity:105/353 - (29%)
Similarity:162/353 - (45%) Gaps:101/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EESEYSENEDTQVCDKDSQQN--SNADSGYPLDSP-------ELQDSKTTGQKGQNKS------G 71
            ||.:|....|         ||  :..::.:|:.|.       ::|::...|....|:.      .
plant    54 EEFQYKITND---------QNFPTTYNTPFPVISEGISYNMHDVQENTMCGYTAHNQGLIIGCHE 109

  Fly    72 KTSIGAVHPNYGFGKRWSKSEDVLL----------KQLVETHGENWEIIGPHFKDRLEQQVQQRW 126
            ...:.||..:..|..  .:|||:.|          |.:.:|..:..:|||               
plant   110 PVLVHAVVESQQFNV--PQSEDINLVSQSERVTEDKVMFKTDHKKKDIIG--------------- 157

  Fly   127 AKVLNPELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAW 191
                     ||.||..||::::::|::.|.|.||.||:...||:||||||||||||.|||||..|
plant   158 ---------KGQWTPTEDELLVRMVKSKGTKNWTSIAKMFQGRVGKQCRERWHNHLRPNIKKNDW 213

  Fly   192 TEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRT 256
            :|:||:|:.:.|..:||:|.:||||||||::|.:|||||:|.||.:     ||....||..|.|.
plant   214 SEEEDQILIEVHKIVGNKWTEIAKRLPGRSENIVKNHWNATKRRLH-----SVRTKRSDAFSPRN 273

  Fly   257 H-LITLIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAH 320
            : |...|:|..|:   ||...|:|..             |:||        .|:.|..:..|:  
plant   274 NALENYIRSITIN---NNALMNREVD-------------SITA--------NSEIDSTRCENI-- 312

  Fly   321 LSMQHLIKLTMPRQTPIILKRTRKHIPE 348
              :..::.|.:...|.:       ::||
plant   313 --VDEVMNLNLHATTSV-------YVPE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 9/56 (16%)
Myb_DNA-bind_6 88..147 CDD:290632 15/68 (22%)
SANT 136..184 CDD:197842 27/47 (57%)
Myb_DNA-bind_6 139..197 CDD:290632 33/57 (58%)
SANT 188..235 CDD:197842 25/46 (54%)
Myb_DNA-binding 188..233 CDD:278669 24/44 (55%)
Cmyb_C 388..530 CDD:286408
MYB115NP_568581.1 SANT 158..>258 CDD:333364 57/99 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45614
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.