DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB24

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_198851.1 Gene:MYB24 / 834033 AraportID:AT5G40350 Length:214 Species:Arabidopsis thaliana


Alignment Length:148 Identity:56/148 - (37%)
Similarity:78/148 - (52%) Gaps:8/148 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEKED 196
            |:.|||||.:||.::|..:.|.|...|..:|:... .|.||.||.||.|:|.|::::...|.:|.
plant    16 EVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQ 80

  Fly   197 EIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITL 261
            ..|.:.|.:.||:|:||||.|||||||.|||.|. |..:||.::.......||.......|..| 
plant    81 LTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWR-TKIQKYIIKSGETTTVGSQSSEFINHHAT- 143

  Fly   262 IKSGGISKCMNNMQHNKE 279
                 .|..||:.|...:
plant   144 -----TSHVMNDTQETMD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 8/13 (62%)
PLN03212 136..>236 CDD:178751 45/100 (45%)
Cmyb_C 388..>484 CDD:462753
MYB24NP_198851.1 PLN03212 17..>125 CDD:178751 47/108 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.