DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and TT2

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001331958.1 Gene:TT2 / 833520 AraportID:AT5G35550 Length:261 Species:Arabidopsis thaliana


Alignment Length:220 Identity:64/220 - (29%)
Similarity:102/220 - (46%) Gaps:41/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDN 223
            ::..::.|  |.||.||.||.|:|.|.||:...:..|:|:|.:.|..|||:|:.||.||||||||
plant    43 IVLAHIKGLKRCGKSCRLRWKNYLRPGIKRGNISSDEEELIIRLHNLLGNRWSLIAGRLPGRTDN 107

  Fly   224 AIKNHWNSTMRRKYDVERRSVNASGSDLKSS--RTHLITLIKSGGISKCMNNM------QHNKES 280
            .|||||||.:|::..   ::.......:|.|  ..:.:.:|::..| :|...:      ...|.|
plant   108 EIKNHWNSNLRKRLP---KTQTKQPKRIKHSTNNENNVCVIRTKAI-RCSKTLLFSDLSLQKKSS 168

  Fly   281 GGEAVNKSENAD--GASVTAVKGGDLAQESQDDHQK--------------GSNLAHLSMQHLIKL 329
            ......|.:..|  |:|:.    |||..:....|.:              |:..:.:|...::..
plant   169 TSPLPLKEQEMDQGGSSLM----GDLEFDFDRIHSEFHFPDLMDFDGLDCGNVTSLVSSNEILGE 229

  Fly   330 TMPRQTPIILKRTRKHIPET--HHQ 352
            .:|.|..:.|.|     |.|  ||:
plant   230 LVPAQGNLDLNR-----PFTSCHHR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632
SANT 136..184 CDD:197842 10/24 (42%)
Myb_DNA-bind_6 139..197 CDD:290632 14/37 (38%)
SANT 188..235 CDD:197842 25/46 (54%)
Myb_DNA-binding 188..233 CDD:278669 25/44 (57%)
Cmyb_C 388..530 CDD:286408
TT2NP_001331958.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.