DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB9

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_197179.2 Gene:MYB9 / 831540 AraportID:AT5G16770 Length:336 Species:Arabidopsis thaliana


Alignment Length:299 Identity:86/299 - (28%)
Similarity:132/299 - (44%) Gaps:76/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIARY--LNGRIGKQCRERWHNHLNPNIKKTAWTEKED 196
            |.|||||::|||.:|..::..|...|..:.:.  || |.||.||.||.|:|.|:||:..:||:|:
plant    12 LKKGPWTQEEDDKLIDHIQKHGHGSWRALPKQAGLN-RCGKSCRLRWTNYLRPDIKRGNFTEEEE 75

  Fly   197 EIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTH---- 257
            :.|...|..|||:|:.||..|||||||.|||:||:.:|:|       :...|.|..:.|..    
plant    76 QTIINLHSLLGNKWSSIAGNLPGRTDNEIKNYWNTHLRKK-------LLQMGIDPVTHRPRTDHL 133

  Fly   258 -----LITLIKSGGISKCMN---NMQHNKESGGEAV------------NKSENADGASVTA---- 298
                 |..||.:...:..:|   |:|.:..:..:|.            |.:.|...:|.|.    
plant   134 NVLAALPQLIAAANFNSLLNLNQNVQLDATTLAKAQLLHTMIQVLSTNNNTTNPSFSSSTMQNSN 198

  Fly   299 --VKGGDLAQESQDDHQKGSNLAH-LSMQHLIKLTM-----------PRQ---------TPIILK 340
              :.|.....|:|:...:..|.:| |..::|:..|.           |.|         .|:::.
plant   199 TNLFGQASYLENQNLFGQSQNFSHILEDENLMVKTQIIDNPLDSFSSPIQPGFQDDHNSLPLLVP 263

  Fly   341 RTRKHIPET-------------HHQAG--CSSSETFNQE 364
            .:.:...||             ||.|.  .||:.||.|:
plant   264 ASPEESKETQRMIKNKDIVDYHHHDASNPSSSNSTFTQD 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 9/12 (75%)
SANT 136..184 CDD:197842 22/49 (45%)
Myb_DNA-bind_6 139..197 CDD:290632 25/59 (42%)
SANT 188..235 CDD:197842 23/46 (50%)
Myb_DNA-binding 188..233 CDD:278669 23/44 (52%)
Cmyb_C 388..530 CDD:286408
MYB9NP_197179.2 PLN03091 1..>200 CDD:215570 65/195 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.