DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB66

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_196979.1 Gene:MYB66 / 831327 AraportID:AT5G14750 Length:203 Species:Arabidopsis thaliana


Alignment Length:196 Identity:65/196 - (33%)
Similarity:101/196 - (51%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NPELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEK 194
            |.|..||.||.:||.:::..|:..|...|..||:... .|.||.||.||.|:|:||:|:..:||:
plant    13 NNEYKKGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVKRGNFTEQ 77

  Fly   195 EDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLI 259
            |:::|.:.|..|||:|:.||||:||||||.:||:||:.:.:|..::.                  
plant    78 EEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGIKD------------------ 124

  Fly   260 TLIKSGGISKCMNNMQHNKESGGEAV------NKSENADGASVTAVKGGD--LAQESQDDHQKGS 316
                           |..|:|.|:.|      |.:|.::...::.:...:  |..|.|:||| ||
plant   125 ---------------QKTKQSNGDIVYQINLPNPTETSEETKISNIVDNNNILGDEIQEDHQ-GS 173

  Fly   317 N 317
            |
plant   174 N 174

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity