DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB40

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_196938.2 Gene:MYB40 / 831284 AraportID:AT5G14340 Length:275 Species:Arabidopsis thaliana


Alignment Length:180 Identity:59/180 - (32%)
Similarity:95/180 - (52%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKED 196
            |.:||||.:||..::..:.|.|...|.::.: |.|  |.||.||.||.|:|.|::|:..:|:.|:
plant    24 LKRGPWTIEEDHRLMNFILNNGIHCWRIVPK-LAGLLRCGKSCRLRWINYLRPDLKRGGFTDAEE 87

  Fly   197 EIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITL 261
            :.|.:.|.:|||:|:|||....|||||.||||||:.:::|       :...|.|   ..||    
plant    88 DRIMELHSQLGNRWSKIASHFSGRTDNEIKNHWNTKIKKK-------MKHLGLD---PATH---- 138

  Fly   262 IKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDD 311
                   |.||::.|..:.     |:.:..:..| |..:|.::..::..|
plant   139 -------KPMNDITHQTDP-----NQDKKPNMCS-TINEGEEIKDQTPKD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 7/12 (58%)
PLN03212 136..>236 CDD:178751 44/101 (44%)
Cmyb_C 388..>484 CDD:462753
MYB40NP_196938.2 PLN03091 13..>194 CDD:215570 59/180 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.