DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB92

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_196590.1 Gene:MYB92 / 830892 AraportID:AT5G10280 Length:334 Species:Arabidopsis thaliana


Alignment Length:418 Identity:104/418 - (24%)
Similarity:159/418 - (38%) Gaps:137/418 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIARY--LNGRIGKQCRERWHNHLNPNIKKTAWTEKED 196
            |.|||||.|||:.::..|:..|...|..:.:.  || |.||.||.||.|:|.|:||:..::..|:
plant    12 LKKGPWTPDEDEKLVNYVQKHGHSSWRALPKLAGLN-RCGKSCRLRWTNYLRPDIKRGRFSPDEE 75

  Fly   197 EIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITL 261
            :.|...|..|||:|:.||.:|||||||.|||.||:.:::|                        |
plant    76 QTILNLHSVLGNKWSTIANQLPGRTDNEIKNFWNTHLKKK------------------------L 116

  Fly   262 IKSGGISKCMNNMQHNKE----SG-GEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHL 321
            |:.|     .:.|.|...    || .:.::.|.|..|..       ||.|:...|.:        
plant   117 IQMG-----FDPMTHRPRTDIFSGLSQLMSLSSNLRGFV-------DLQQQFPIDQE-------- 161

  Fly   322 SMQHLIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPSSPVISPIKSL 386
              ..::||    ||.:...:..:::.:.     .|.|...|           |.....:|.:.|:
plant   162 --HTILKL----QTEMAKLQLFQYLLQP-----SSMSNNVN-----------PNDFDTLSLLNSI 204

  Fly   387 PFSPSHFLKSPCLTTFEDMDLR---------ASTPVTKVYNRVGMEIKKEMETSSI-----ETPH 437
                :.|.::...||..::||.         .|.|..|..|       ..||.||:     :..|
plant   205 ----ASFKETSNNTTSNNLDLGFLGSYLQDFHSLPSLKTLN-------SNMEPSSVFPQNLDDNH 258

  Fly   438 KSQLGPRTPTPFKKALAAIGKKRDGRRYEP---SSPSSLVEDLAEIIHEEHLSNSLTANNSKMMG 499
                       ||     ...:|:.....|   |.|||..        ..|:::.|..|   ..|
plant   259 -----------FK-----FSTQRENLPVSPIWLSDPSSTT--------PAHVNDDLIFN---QYG 296

  Fly   500 AADQNSTLSTEYNAQS--------PPHM 519
            ..|.||.:::....:|        |.|:
plant   297 IEDVNSNITSSSGQESGASASAAWPDHL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 9/12 (75%)
SANT 136..184 CDD:197842 22/49 (45%)
Myb_DNA-bind_6 139..197 CDD:290632 23/59 (39%)
SANT 188..235 CDD:197842 21/46 (46%)
Myb_DNA-binding 188..233 CDD:278669 21/44 (48%)
Cmyb_C 388..530 CDD:286408 32/157 (20%)
MYB92NP_196590.1 PLN03091 1..>281 CDD:215570 93/362 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.