Sequence 1: | NP_511170.1 | Gene: | Myb / 32543 | FlyBaseID: | FBgn0002914 | Length: | 657 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_196386.1 | Gene: | MYB29 / 830662 | AraportID: | AT5G07690 | Length: | 336 | Species: | Arabidopsis thaliana |
Alignment Length: | 300 | Identity: | 73/300 - (24%) |
---|---|---|---|
Similarity: | 109/300 - (36%) | Gaps: | 117/300 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEKEDE 197
Fly 198 IIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRR--------------------------- 235
Fly 236 --------------------------KYDV----ERRSVNASGSDLK---------SSRTHLI-- 259
Fly 260 ----TLIKSGGISKCMNN-----------------------MQHNKESGGEAVNKSE-------- 289
Fly 290 ---NADGASVTAVKGG--------DLAQESQDDHQKGSNL 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Myb | NP_511170.1 | SANT | 85..132 | CDD:197842 | |
Myb_DNA-bind_6 | 88..147 | CDD:290632 | 7/12 (58%) | ||
SANT | 136..184 | CDD:197842 | 19/48 (40%) | ||
Myb_DNA-bind_6 | 139..197 | CDD:290632 | 21/58 (36%) | ||
SANT | 188..235 | CDD:197842 | 20/46 (43%) | ||
Myb_DNA-binding | 188..233 | CDD:278669 | 20/44 (45%) | ||
Cmyb_C | 388..530 | CDD:286408 | |||
MYB29 | NP_196386.1 | PLN03091 | 1..>140 | CDD:215570 | 43/127 (34%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5147 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |