DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB73

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_195443.1 Gene:MYB73 / 829880 AraportID:AT4G37260 Length:320 Species:Arabidopsis thaliana


Alignment Length:188 Identity:76/188 - (40%)
Similarity:111/188 - (59%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NPELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKE 195
            |.|.|||||:.:|||::.:||:..||:.|:||::.:.||.||.||.||.|.|:|.::..|::::|
plant     8 NMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFSQEE 72

  Fly   196 DEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGS-----DLKSSR 255
            ||.|.:||...||:||.|::.|.||||||||||||||::||..||.:|.:..|:     :|...:
plant    73 DETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFGGNGGYDGNLGEEQ 137

  Fly   256 THLITLIKSGGISKCMNNMQHNKESGGEAVNKSENADG----------ASVTAVKGGD 303
            ....|....||:|..: .|.....||.:.   ||.:.|          :.|||...|:
plant   138 PLKRTASGGGGVSTGL-YMSPGSPSGSDV---SEQSSGGAHVFKPTVRSEVTASSSGE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 10/15 (67%)
PLN03212 136..>236 CDD:178751 52/99 (53%)
Cmyb_C 388..>484 CDD:462753
MYB73NP_195443.1 PLN03091 13..>113 CDD:215570 52/99 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.