DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB73

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_195443.1 Gene:MYB73 / 829880 AraportID:AT4G37260 Length:320 Species:Arabidopsis thaliana


Alignment Length:188 Identity:76/188 - (40%)
Similarity:111/188 - (59%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NPELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKE 195
            |.|.|||||:.:|||::.:||:..||:.|:||::.:.||.||.||.||.|.|:|.::..|::::|
plant     8 NMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFSQEE 72

  Fly   196 DEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGS-----DLKSSR 255
            ||.|.:||...||:||.|::.|.||||||||||||||::||..||.:|.:..|:     :|...:
plant    73 DETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFGGNGGYDGNLGEEQ 137

  Fly   256 THLITLIKSGGISKCMNNMQHNKESGGEAVNKSENADG----------ASVTAVKGGD 303
            ....|....||:|..: .|.....||.:.   ||.:.|          :.|||...|:
plant   138 PLKRTASGGGGVSTGL-YMSPGSPSGSDV---SEQSSGGAHVFKPTVRSEVTASSSGE 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity