DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB32

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_195225.1 Gene:MYB32 / 829651 AraportID:AT4G34990 Length:274 Species:Arabidopsis thaliana


Alignment Length:165 Identity:59/165 - (35%)
Similarity:88/165 - (53%) Gaps:20/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEKEDEII 199
            ||.||::|||.:|..::..|...|..:.|... .|.||.||.||.|:|.|::|:..:|.:||::|
plant    14 KGAWTKEEDDKLISYIKAHGEGCWRSLPRSAGLQRCGKSCRLRWINYLRPDLKRGNFTLEEDDLI 78

  Fly   200 YQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKY------DVERRSVNAS-----GSDLKS 253
            .:.|..|||:|:.||.||||||||.|||:||:.::||.      ....|.:|.:     .||...
plant    79 IKLHSLLGNKWSLIATRLPGRTDNEIKNYWNTHVKRKLLRKGIDPATHRPINETKTSQDSSDSSK 143

  Fly   254 SRTHLITLIKSG-GISKCMNNMQHNKESGGEAVNK 287
            :...|:.::..| .:.|..|       .|.|.:.|
plant   144 TEDPLVKILSFGPQLEKIAN-------FGDERIQK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 7/10 (70%)
SANT 136..184 CDD:197842 20/48 (42%)
Myb_DNA-bind_6 139..197 CDD:290632 22/58 (38%)
SANT 188..235 CDD:197842 24/46 (52%)
Myb_DNA-binding 188..233 CDD:278669 24/44 (55%)
Cmyb_C 388..530 CDD:286408
MYB32NP_195225.1 SANT 14..63 CDD:197842 20/48 (42%)
Myb_DNA-binding 14..61 CDD:278669 19/46 (41%)
SANT 67..114 CDD:197842 24/46 (52%)
Myb_DNA-binding 67..111 CDD:278669 24/43 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.