DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB97

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_194423.1 Gene:MYB97 / 828800 AraportID:AT4G26930 Length:389 Species:Arabidopsis thaliana


Alignment Length:452 Identity:112/452 - (24%)
Similarity:169/452 - (37%) Gaps:162/452 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIAR--YLNGRIGKQCRERWHNHLNPNIKKTAWTEKED 196
            |.|||||..||:.:...||.:|...|..:.:  :| .|.||.||.||.|||.||::|.::|.:|:
plant    19 LKKGPWTVAEDETLAAYVREYGEGNWNSVQKKTWL-ARCGKSCRLRWANHLRPNLRKGSFTPEEE 82

  Fly   197 EIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITL 261
            .:|.|.|.:|||:||::|.:|||||||.|||:||:.::|        ....|..|..        
plant    83 RLIIQLHSQLGNKWARMAAQLPGRTDNEIKNYWNTRLKR--------FQRQGLPLYP-------- 131

  Fly   262 IKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQHL 326
                                                       .:.||::||:.......|.   
plant   132 -------------------------------------------PEYSQNNHQQQMYPQQPSS--- 150

  Fly   327 IKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPS-------SPVISPIK 384
               .:|.|||                   :||.||        ...:|||       :...||..
plant   151 ---PLPSQTP-------------------ASSFTF--------PLLQPPSLCPKRCYNTAFSPKA 185

  Fly   385 SLPFSPSHFL-KSPC-LTTFEDMDLRASTPVTKVYNRVGMEIKKEMETSSIETPHKSQLGPRTPT 447
            |...||::|| .||. |.|...:....||  ..||:     :|.|:  ||.:.|:.:.||....:
plant   186 SYISSPTNFLVSSPTFLHTHSSLSSYQST--NPVYS-----MKHEL--SSNQIPYSASLGVYQVS 241

  Fly   448 PFKKALAAIGKKRDGRRYEPSSPSSLVEDLAEIIHEEHLSNSLTA-NNSKMMGAADQNSTLSTEY 511
            .|............|..   ::...|:|||.|  ..|.|::|..| ...::|.|.:.|:      
plant   242 KFSDNGDCNQNLNTGLH---TNTCQLLEDLME--EAEALADSFRAPKRRQIMAALEDNN------ 295

  Fly   512 NAQSPPHMKRARKSLLSTWSSNHPYNAGSAKRIQPFETETPSKFLTSPGDILKDTLCSEQDL 573
                               ::|:.::.|...|:.                  .::|||.|.|
plant   296 -------------------NNNNFFSGGFGHRVS------------------SNSLCSLQGL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 8/12 (67%)
SANT 136..184 CDD:197842 22/49 (45%)
Myb_DNA-bind_6 139..197 CDD:290632 24/59 (41%)
SANT 188..235 CDD:197842 24/46 (52%)
Myb_DNA-binding 188..233 CDD:278669 24/44 (55%)
Cmyb_C 388..530 CDD:286408 33/144 (23%)
MYB97NP_194423.1 SANT 19..>150 CDD:333364 56/190 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.