DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB39

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_567540.2 Gene:MYB39 / 827500 AraportID:AT4G17785 Length:360 Species:Arabidopsis thaliana


Alignment Length:377 Identity:97/377 - (25%)
Similarity:156/377 - (41%) Gaps:81/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARY--LNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEI 198
            ||||..:|||.:...:...|...|..:.:.  || |.||.||.||.|:|.|:|::..:::.|:..
plant    15 KGPWLPEEDDKLTAYINENGYGNWRSLPKLAGLN-RCGKSCRLRWMNYLRPDIRRGKFSDGEEST 78

  Fly   199 IYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSD--LKSSRTHLIT- 260
            |.:.|..|||:|:|||..|||||||.|||:||:.||:|       :...|.|  ....||:.:: 
plant    79 IVRLHALLGNKWSKIAGHLPGRTDNEIKNYWNTHMRKK-------LLQMGIDPVTHEPRTNDLSP 136

  Fly   261 -LIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQ 324
             |..|..::..:||.|....:   .:|.:        ||::                ::..|.:.
plant   137 ILDVSQMLAAAINNGQFGNNN---LLNNN--------TALE----------------DILKLQLI 174

  Fly   325 H-LIKLTMPRQTPIILK-RTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPSSPVISPIKSLP 387
            | ::::..|:..|.|.. :|....|:.....     .:||....  |.:..||:...|:.....|
plant   175 HKMLQIITPKAIPNISSFKTNLLNPKPEPVV-----NSFNTNSV--NPKPDPPAGLFINQSGITP 232

  Fly   388 FSPSHFLKS-------------PCLTTFEDMDLRASTPVTKVYNRVGMEIKKEM-----ETSSIE 434
            .:.|.|:.|             |.|.|.....|..:.|.|....:|...|:..|     ....:|
plant   233 EAASDFIPSYENVWDGFEDNQLPGLVTVSQESLNTAKPGTSTTTKVNDHIRTGMMPCYYGDQLLE 297

  Fly   435 TPHKS--QLGPRTPTPFKKALAAIGKKRDGRRYEPSSPSSLVEDLAEIIHEE 484
            ||...  .:.|.|.:....:.|           :.||.|..:||..:.:.:|
plant   298 TPSTGSVSVSPETTSLNHPSTA-----------QHSSGSDFLEDWEKFLDDE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 7/10 (70%)
SANT 136..184 CDD:197842 20/49 (41%)
Myb_DNA-bind_6 139..197 CDD:290632 20/59 (34%)
SANT 188..235 CDD:197842 23/46 (50%)
Myb_DNA-binding 188..233 CDD:278669 22/44 (50%)
Cmyb_C 388..530 CDD:286408 24/117 (21%)
MYB39NP_567540.2 SANT 15..64 CDD:197842 20/49 (41%)
Myb_DNA-binding 15..62 CDD:278669 19/47 (40%)
SANT 68..115 CDD:197842 23/46 (50%)
Myb_DNA-binding 68..113 CDD:278669 22/44 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.