DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB102

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_567626.1 Gene:MYB102 / 826916 AraportID:AT4G21440 Length:350 Species:Arabidopsis thaliana


Alignment Length:400 Identity:94/400 - (23%)
Similarity:155/400 - (38%) Gaps:120/400 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEKEDE 197
            |.|||||.:||..::..::..|...|..:.:... .|.||.||.||.|:|.|:||:..::.:|:|
plant    12 LKKGPWTSEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYLRPDIKRGRFSFEEEE 76

  Fly   198 IIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLI 262
            .|.|.|..|||:|:.||.||||||||.|||.||:.:|:|                        |:
plant    77 TIIQLHSFLGNKWSAIAARLPGRTDNEIKNFWNTHIRKK------------------------LL 117

  Fly   263 KSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQHLI 327
            :                .|.:.|..|...|...::::....|...|..         |::|..|:
plant   118 R----------------MGIDPVTHSPRLDLLDISSILASSLYNSSSH---------HMNMSRLM 157

  Fly   328 KLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPSSPVISPIKSLPFSPSH 392
            ..|..|                |||                       ..|:::| :.|..:.|.
plant   158 MDTNRR----------------HHQ-----------------------QHPLVNP-EILKLATSL 182

  Fly   393 FLKSPCLTTFEDMDLRASTPVTKVYNRVGME-----------IKKEMETSSIETPHKSQLGPRTP 446
            |.::.......|.|.|.....| ||::.|:.           |.:|:::|....|::::......
plant   183 FSQNQNQNLVVDHDSRTQEKQT-VYSQTGVNQYQTNQYFENTITQELQSSMPPFPNEARQFNNMD 246

  Fly   447 TPFKKALAAIGKKRDGRRYEPSSPSSLVEDLAEIIHEEHLSNSLTANNSKMMGAADQ-----NST 506
            ..|...         |.:...|:.::.|:|.......::.|::...:.|    .:||     ||.
plant   247 HHFNGF---------GEQNLVSTSTTSVQDCYNPSFNDYSSSNFVLDPS----YSDQSFNFANSV 298

  Fly   507 LSTEYNAQSP 516
            |:|..::.||
plant   299 LNTPSSSPSP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 8/12 (67%)
SANT 136..184 CDD:197842 18/48 (38%)
Myb_DNA-bind_6 139..197 CDD:290632 19/58 (33%)
SANT 188..235 CDD:197842 24/46 (52%)
Myb_DNA-binding 188..233 CDD:278669 24/44 (55%)
Cmyb_C 388..530 CDD:286408 27/144 (19%)
MYB102NP_567626.1 SANT 4..>128 CDD:333364 51/155 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.