DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB55

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001031571.1 Gene:MYB55 / 826853 AraportID:AT4G01680 Length:348 Species:Arabidopsis thaliana


Alignment Length:329 Identity:81/329 - (24%)
Similarity:136/329 - (41%) Gaps:97/329 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ELIKGPWTRDEDDMVIKLVRNFGPKKWTLIAR-----------YLNG--RIGKQCRERWHNHLNP 184
            :|.||.|:.:||:.:::.:..:|...|:.:.:           .|.|  |.||.||.||.|:|.|
plant    11 KLRKGLWSPEEDEKLLRYITKYGHGCWSSVPKQAGTFLFIQIHLLFGLQRCGKSCRLRWINYLRP 75

  Fly   185 NIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVN---- 245
            ::|:.|:::.|:.:|.:.|..|||:|::||.:|||||||.|||.|||.:::|  :..|.::    
plant    76 DLKRGAFSQDEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKK--LRLRGIDPVTH 138

  Fly   246 ------ASGSD------LKSSRTHLITLIKSGGISKCMNNMQHNKE---SGGEAVNKSENADGAS 295
                  .:|:|      .||.:|:|:....|...:.|..|..:|.:   :|.....:....:|:.
plant   139 KLLTEIETGTDDKTKPVEKSQQTYLVETDGSSSTTTCSTNQNNNTDHLYTGNFGFQRLSLENGSR 203

  Fly   296 VTAVKGGDLA----QESQDDHQ------------------------KGSNLAHLSMQHLIKLTMP 332
            :.|  |.||.    |..::.|.                        :.|||..:.:::... |.|
plant   204 IAA--GSDLGIWIPQTGRNHHHHVDETIPSAVVLPGSMFSSGLTGYRSSNLGLIELENSFS-TGP 265

  Fly   333 RQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNAR----------------SRPPSSPVIS 381
            ..|             .|.|.   ....:|.....||..                |...:|.:.|
plant   266 MMT-------------EHQQI---QESNYNNSTFFGNGNLNWGLTMEENQNPFTISNHSNSSLYS 314

  Fly   382 PIKS 385
            .|||
plant   315 DIKS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 6/13 (46%)
SANT 136..184 CDD:197842 18/60 (30%)
Myb_DNA-bind_6 139..197 CDD:290632 20/70 (29%)
SANT 188..235 CDD:197842 23/46 (50%)
Myb_DNA-binding 188..233 CDD:278669 23/44 (52%)
Cmyb_C 388..530 CDD:286408
MYB55NP_001031571.1 PLN03091 1..343 CDD:215570 81/329 (25%)
Myb_DNA-binding 14..73 CDD:278669 17/58 (29%)
Myb_DNA-binding 79..124 CDD:278669 23/44 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.