Sequence 1: | NP_511170.1 | Gene: | Myb / 32543 | FlyBaseID: | FBgn0002914 | Length: | 657 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_190461.1 | Gene: | MYB45 / 824053 | AraportID: | AT3G48920 | Length: | 261 | Species: | Arabidopsis thaliana |
Alignment Length: | 206 | Identity: | 61/206 - (29%) |
---|---|---|---|
Similarity: | 102/206 - (49%) | Gaps: | 21/206 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEKEDEII 199
Fly 200 YQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLIKS 264
Fly 265 GGISKCMNNMQHNKESGGEAVNKSE--NADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQHLI 327
Fly 328 KLTMPRQTPII 338 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Myb | NP_511170.1 | SANT | 85..132 | CDD:197842 | |
Myb_DNA-bind_6 | 88..147 | CDD:290632 | 5/10 (50%) | ||
SANT | 136..184 | CDD:197842 | 18/48 (38%) | ||
Myb_DNA-bind_6 | 139..197 | CDD:290632 | 21/58 (36%) | ||
SANT | 188..235 | CDD:197842 | 23/46 (50%) | ||
Myb_DNA-binding | 188..233 | CDD:278669 | 23/44 (52%) | ||
Cmyb_C | 388..530 | CDD:286408 | |||
MYB45 | NP_190461.1 | PLN03091 | 15..>126 | CDD:215570 | 43/105 (41%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5147 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |