DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB110

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001078220.1 Gene:MYB110 / 822542 AraportID:AT3G29020 Length:305 Species:Arabidopsis thaliana


Alignment Length:254 Identity:75/254 - (29%)
Similarity:111/254 - (43%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEIIY 200
            :|.|...||..:::||..:||:.|..||..:.||.||.||.||.|.|:|.|.|.|::::|:|.:.
plant    67 RGHWRISEDTQLMELVSVYGPQNWNHIAESMQGRTGKSCRLRWFNQLDPRINKRAFSDEEEERLL 131

  Fly   201 QAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSV--NASGSDLKSSRTHLITLIK 263
            .||...||:||.|||...||||||:||||:..|.||...:..|.  ..:||..:|:..|.|..:.
plant   132 AAHRAFGNKWAMIAKLFNGRTDNALKNHWHVLMARKMRQQSSSYVQRFNGSAHESNTDHKIFNLS 196

  Fly   264 SGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDL---AQESQDDHQKGSNLAHLSMQH 325
            .|.:..                ::..|....|...:|.|..   ||..|:::...          
plant   197 PGNVDD----------------DEDVNLKKCSWEMLKEGTTNLKAQYLQEEYSSS---------- 235

  Fly   326 LIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFN-------QEEAAGNARSRPPSS 377
                .||.|.|             ||......:::..       ||.::.::.|.|.||
plant   236 ----RMPMQGP-------------HHHYSTFPADSLALTLHVSIQEPSSSSSLSLPSSS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 4/10 (40%)
SANT 136..184 CDD:197842 21/47 (45%)
Myb_DNA-bind_6 139..197 CDD:290632 25/57 (44%)
SANT 188..235 CDD:197842 24/46 (52%)
Myb_DNA-binding 188..233 CDD:278669 23/44 (52%)
Cmyb_C 388..530 CDD:286408
MYB110NP_001078220.1 SANT 67..115 CDD:197842 21/47 (45%)
Myb_DNA-binding 67..113 CDD:278669 20/45 (44%)
SANT 119..166 CDD:197842 24/46 (52%)
Myb_DNA-binding 119..164 CDD:278669 23/44 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45614
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.