DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and TDF1

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_189488.1 Gene:TDF1 / 822477 AraportID:AT3G28470 Length:317 Species:Arabidopsis thaliana


Alignment Length:372 Identity:87/372 - (23%)
Similarity:152/372 - (40%) Gaps:114/372 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARY--LNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEI 198
            ||.||.:||..::..|...|...|:||.:.  || |.||.||.||.|:|.|::|..:::.:|:|:
plant    14 KGLWTEEEDAKILAYVAIHGVGNWSLIPKKAGLN-RCGKSCRLRWTNYLRPDLKHDSFSTQEEEL 77

  Fly   199 IYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLIK 263
            |.:.|..:|::|:.||::|||||||.:|||||:.:::|                        |:|
plant    78 IIECHRAIGSRWSSIARKLPGRTDNDVKNHWNTKLKKK------------------------LMK 118

  Fly   264 SG-------GISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGG-DLAQESQDDHQKGSNLAH 320
            .|       .:|:.:...: |....|.|..|:|.::.:.:|..... ::.:.:..:|:       
plant   119 MGIDPVTHKPVSQLLAEFR-NISGHGNASFKTEPSNNSILTQSNSAWEMMRNTTTNHE------- 175

  Fly   321 LSMQHLIKLTMPRQTPIILKRTRKHIPETHH------------QAGCSSSETFNQEEAAGNARSR 373
                     :....:|::...:.::.....|            .:.||||.              
plant   176 ---------SYYTNSPMMFTNSSEYQTTPFHFYSHPNHLLNGTTSSCSSSS-------------- 217

  Fly   374 PPSSPVISPIKSLPFSPSHFLKSPCLTTFEDMDLRASTPVTKVYNRVGMEIKKEMETS------S 432
              ||..|:....:|.:|        :|.|...|...|.||.:|   ||.....::..:      :
plant   218 --SSTSITQPNQVPQTP--------VTNFYWSDFLLSDPVPQV---VGSSATSDLTFTQNEHHFN 269

  Fly   433 IETPHKSQLGPRTPTPFKKALAAIGKKRDGRRYEPSSPSSLVEDLAE 479
            ||..:.||              .|..|..|..:   |.||.|:::.:
plant   270 IEAEYISQ--------------NIDSKASGTCH---SASSFVDEILD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 6/10 (60%)
SANT 136..184 CDD:197842 22/49 (45%)
Myb_DNA-bind_6 139..197 CDD:290632 23/59 (39%)
SANT 188..235 CDD:197842 20/46 (43%)
Myb_DNA-binding 188..233 CDD:278669 20/44 (45%)
Cmyb_C 388..530 CDD:286408 21/98 (21%)
TDF1NP_189488.1 PLN03091 1..>131 CDD:215570 48/141 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.