DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB21

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_189418.2 Gene:MYB21 / 822401 AraportID:AT3G27810 Length:226 Species:Arabidopsis thaliana


Alignment Length:213 Identity:69/213 - (32%)
Similarity:102/213 - (47%) Gaps:26/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLN-GRIGKQCRERWHNHLNPNIKKTAWTEKED 196
            |:.|||||.:||.::|..:.|.|...|..:|:... .|.||.||.||.|:|.|::::...|.:|.
plant    19 EVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQ 83

  Fly   197 EIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITL 261
            .||.:.|.:.||:|:||||.|||||||.|||.|. |..:|| :::..|..:    .|..:|..:.
plant    84 LIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWR-TRIQKY-IKQSDVTTT----SSVGSHHSSE 142

  Fly   262 IKSGGISKCMNNMQHNKESGGEAVNKSE-------------NADGASVTAVKGGDLAQESQDDHQ 313
            |.....|...:|:...::...|..:.:.             |...|:|||..  |.......|.|
plant   143 INDQAASTSSHNVFCTQDQAMETYSPTPTSYQHTNMEFNYGNYSAAAVTATV--DYPVPMTVDDQ 205

  Fly   314 KGSNLAHL----SMQHLI 327
            .|.|...:    |..||:
plant   206 TGENYWGMDDIWSSMHLL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 8/13 (62%)
PLN03212 136..>236 CDD:178751 46/100 (46%)
Cmyb_C 388..>484 CDD:462753
MYB21NP_189418.2 PLN03091 19..>126 CDD:215570 49/108 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.