DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB57

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_186802.1 Gene:MYB57 / 821113 AraportID:AT3G01530 Length:206 Species:Arabidopsis thaliana


Alignment Length:198 Identity:66/198 - (33%)
Similarity:104/198 - (52%) Gaps:31/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKEDEI 198
            |||||.:||.::...:.|.|...|..:|: .:|  |.||.||.||.|:|.|::::...||:|..:
plant    27 KGPWTMEEDFILFNYILNHGEGLWNSVAK-ASGLKRTGKSCRLRWLNYLRPDVRRGNITEEEQLL 90

  Fly   199 IYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLIK 263
            |.|.|.:|||:|:||||.|||||||.|||.|.:.::|...|       |..::.:.:.|      
plant    91 IIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMKV-------SSENMMNHQHH------ 142

  Fly   264 SGGISKCMNNMQHN----KESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQ 324
                  |..|.|.:    :.|.|:|::.:|:...|..|..  ..:.|:|.:::.   |:..|...
plant   143 ------CSGNSQSSGMTTQGSSGKAIDTAESFSQAKTTTF--NVVEQQSNENYW---NVEDLWPV 196

  Fly   325 HLI 327
            ||:
plant   197 HLL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 7/10 (70%)
PLN03212 136..>236 CDD:178751 47/101 (47%)
Cmyb_C 388..>484 CDD:462753
MYB57NP_186802.1 PLN03091 25..>130 CDD:215570 48/103 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.