Sequence 1: | NP_511170.1 | Gene: | Myb / 32543 | FlyBaseID: | FBgn0002914 | Length: | 657 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_186802.1 | Gene: | MYB57 / 821113 | AraportID: | AT3G01530 | Length: | 206 | Species: | Arabidopsis thaliana |
Alignment Length: | 198 | Identity: | 66/198 - (33%) |
---|---|---|---|
Similarity: | 104/198 - (52%) | Gaps: | 31/198 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKEDEI 198
Fly 199 IYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLIK 263
Fly 264 SGGISKCMNNMQHN----KESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQ 324
Fly 325 HLI 327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Myb | NP_511170.1 | SANT | 85..132 | CDD:197842 | |
Myb_DNA-bind_6 | 88..147 | CDD:290632 | 7/10 (70%) | ||
SANT | 136..184 | CDD:197842 | 21/49 (43%) | ||
Myb_DNA-bind_6 | 139..197 | CDD:290632 | 22/59 (37%) | ||
SANT | 188..235 | CDD:197842 | 25/46 (54%) | ||
Myb_DNA-binding | 188..233 | CDD:278669 | 25/44 (57%) | ||
Cmyb_C | 388..530 | CDD:286408 | |||
MYB57 | NP_186802.1 | SANT | 27..76 | CDD:197842 | 21/49 (43%) |
Myb_DNA-binding | 27..74 | CDD:278669 | 20/47 (43%) | ||
SANT | 80..127 | CDD:197842 | 25/46 (54%) | ||
Myb_DNA-binding | 80..123 | CDD:278669 | 25/42 (60%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5147 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |