Sequence 1: | NP_511170.1 | Gene: | Myb / 32543 | FlyBaseID: | FBgn0002914 | Length: | 657 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_187888.1 | Gene: | MYB10 / 820464 | AraportID: | AT3G12820 | Length: | 239 | Species: | Arabidopsis thaliana |
Alignment Length: | 211 | Identity: | 64/211 - (30%) |
---|---|---|---|
Similarity: | 107/211 - (50%) | Gaps: | 35/211 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKEDEI 198
Fly 199 IYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLI--TL 261
Fly 262 IKSGGISKCMNNM------QHNKESGGEAVNKSENADGASVTAVKGGD-LAQESQ---------- 309
Fly 310 -------DDHQKGSNL 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Myb | NP_511170.1 | SANT | 85..132 | CDD:197842 | |
Myb_DNA-bind_6 | 88..147 | CDD:290632 | 4/10 (40%) | ||
SANT | 136..184 | CDD:197842 | 17/49 (35%) | ||
Myb_DNA-bind_6 | 139..197 | CDD:290632 | 19/59 (32%) | ||
SANT | 188..235 | CDD:197842 | 21/46 (46%) | ||
Myb_DNA-binding | 188..233 | CDD:278669 | 21/44 (48%) | ||
Cmyb_C | 388..530 | CDD:286408 | |||
MYB10 | NP_187888.1 | PLN03091 | 1..>121 | CDD:215570 | 40/107 (37%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5147 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |