DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB83

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_187463.1 Gene:MYB83 / 819997 AraportID:AT3G08500 Length:343 Species:Arabidopsis thaliana


Alignment Length:332 Identity:87/332 - (26%)
Similarity:149/332 - (44%) Gaps:68/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG---RIGKQCRERWHNHLNPNIKKTAWTE 193
            |:|.||.|:.|||:.:|:.:...|...|:.|||  |.   |.||.||.||.|:|.|::|:.:::.
plant    28 PKLRKGLWSPDEDEKLIRYMLTNGQGCWSDIAR--NAGLLRCGKSCRLRWINYLRPDLKRGSFSP 90

  Fly   194 KEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHL 258
            :|:::|:..|..|||:|::||.||||||||.|||.||||::::......:..:|||...:|.::.
plant    91 QEEDLIFHLHSILGNRWSQIATRLPGRTDNEIKNFWNSTLKKRLKNNSNNNTSSGSSPNNSNSNS 155

  Fly   259 I----TLIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLA 319
            :    ..:..||.|..:.:..|:.|:                ....|..:..:|......|..:.
plant   156 LDPRDQHVDMGGNSTSLMDDYHHDEN----------------MMTVGNTMRMDSSSPFNVGPMVN 204

  Fly   320 HLSMQHLIKLTMPRQTPIILKRTRKHIPET-HHQAGCSSSETFNQEEAA--GNARSRPPSSPVIS 381
            .:.:..|       ..|:::.     :|:. :||.| ::...|:.....  ||.        ::.
plant   205 SVGLNQL-------YDPLMIS-----VPDNGYHQMG-NTVNVFSVNGLGDYGNT--------ILD 248

  Fly   382 PIKS----------LPFSPSHFLKSPCLTTFEDMDLRASTPVTKVYN-------RVGMEIKKEME 429
            ||..          :|  ||........:|..:::|:|..|.....|       :||..:..|..
plant   249 PISKRVSVEGDDWFIP--PSENTNVIACSTSNNLNLQALDPCFNSKNLCHSESFKVGNVLGIENG 311

  Fly   430 TSSIETP 436
            :..||.|
plant   312 SWEIENP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 87/332 (26%)
Myb_DNA-bind_6 88..147 CDD:290632 8/14 (57%)
SANT 136..184 CDD:197842 22/50 (44%)
Myb_DNA-bind_6 139..197 CDD:290632 23/60 (38%)
SANT 188..235 CDD:197842 24/46 (52%)
Myb_DNA-binding 188..233 CDD:278669 23/44 (52%)
Cmyb_C 388..530 CDD:286408 13/56 (23%)
MYB83NP_187463.1 PLN03091 27..>135 CDD:215570 50/108 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.