DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB2

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_182241.1 Gene:MYB2 / 819332 AraportID:AT2G47190 Length:273 Species:Arabidopsis thaliana


Alignment Length:237 Identity:69/237 - (29%)
Similarity:108/237 - (45%) Gaps:53/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNG--RIGKQCRERWHNHLNPNIKKTAWTEKEDEI 198
            |||||.:||.:::..|...|..:|..||| .:|  |.||.||.||.|:|.|::::...|.:|..:
plant    22 KGPWTEEEDAILVNFVSIHGDARWNHIAR-SSGLKRTGKSCRLRWLNYLRPDVRRGNITLEEQFM 85

  Fly   199 IYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDL--KSSRT----H 257
            |.:.|...||:|:|||:.|||||||.|||:|.:.::::....|..||   |:|  ::.|.    .
plant    86 ILKLHSLWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKQAKHLRCDVN---SNLFKETMRNVWMPR 147

  Fly   258 LITLIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLS 322
            |:..|.:..:......::.......:.||:....:...|         |.||:.||         
plant   148 LVERINAQSLPTTCEQVESMITDPSQPVNEPSPVEPGFV---------QFSQNHHQ--------- 194

  Fly   323 MQHLIKLTMPRQTPIILKRTRKHIPETHHQAGCSSS--ETFN 362
                                 :.:|.|...|..|:|  |||:
plant   195 ---------------------QFVPATELSATSSNSPAETFS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 7/10 (70%)
SANT 136..184 CDD:197842 23/49 (47%)
Myb_DNA-bind_6 139..197 CDD:290632 23/59 (39%)
SANT 188..235 CDD:197842 21/46 (46%)
Myb_DNA-binding 188..233 CDD:278669 21/44 (48%)
Cmyb_C 388..530 CDD:286408
MYB2NP_182241.1 PLN03212 20..>123 CDD:178751 45/101 (45%)
OapA <143..>209 CDD:225603 14/104 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.