DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB25

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_181517.1 Gene:MYB25 / 818575 AraportID:AT2G39880 Length:367 Species:Arabidopsis thaliana


Alignment Length:257 Identity:82/257 - (31%)
Similarity:124/257 - (48%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 FKDRLEQQVQQRWAKVLNPEL-------IKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIG 171
            |::.:.:.|:...|::...:.       :||||..::|:.:.:||:..||:.|.||:|.:.||.|
plant    21 FENAIHKAVEAELAELAKSDANGGGKSKVKGPWLPEQDEALTRLVKMCGPRNWNLISRGIPGRSG 85

  Fly   172 KQCRERWHNHLNPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRK 236
            |.||.||.|.|:|.:|:..::::|:.:|..|...|||:|:.|||.|||||||||||||||.:|||
plant    86 KSCRLRWCNQLDPILKRKPFSDEEEHMIMSAQAVLGNKWSVIAKLLPGRTDNAIKNHWNSNLRRK 150

  Fly   237 --------------------Y-DVERRSVNASGSDLKSSRTHLITLIKSGGISKCMNNM------ 274
                                | .:.||..||      |.:.||....::|.:|.  :.|      
plant   151 PAEQWKIPLLMSNTEIVYQLYPSMVRRISNA------SPKEHLPQEEETGVLSD--DKMDDEAKE 207

  Fly   275 ---QHNKESGGEAVNKSENADGASVTAVKG------GDLAQESQDDHQKGSNLAHLSMQHLI 327
               :.|.::|   |.:.....||......|      |.|.|.|:.|...|..|..|....:|
plant   208 PPREQNSKTG---VYRPVARMGAFSVCKPGYMAPCEGPLVQASRPDSLAGKFLQSLCYDPII 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 3/17 (18%)
Myb_DNA-bind_6 88..147 CDD:290632 8/39 (21%)
SANT 136..184 CDD:197842 23/47 (49%)
Myb_DNA-bind_6 139..197 CDD:290632 23/57 (40%)
SANT 188..235 CDD:197842 25/46 (54%)
Myb_DNA-binding 188..233 CDD:278669 25/44 (57%)
Cmyb_C 388..530 CDD:286408
MYB25NP_181517.1 PLN03091 50..>150 CDD:215570 51/99 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45614
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.