DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and AS1

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_181299.1 Gene:AS1 / 818340 AraportID:AT2G37630 Length:367 Species:Arabidopsis thaliana


Alignment Length:182 Identity:55/182 - (30%)
Similarity:81/182 - (44%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 WTRDEDDMVIKLVRNFGPKKWTLIARYLN---GRIGKQCRERWHNHLNPNIKKTAWTEKEDEIIY 200
            |:.:||.::...||.|||::|.|::..:|   .|..|.|.|||.|:|.|.|||.:.||:|..::.
plant     7 WSGEEDALLRAYVRQFGPREWHLVSERMNKPLNRDAKSCLERWKNYLKPGIKKGSLTEEEQRLVI 71

  Fly   201 QAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLIKSG 265
            :...:.||:|.|||..:||||...:...| ...:.|...|.:..|.....:..|:...|.     
plant    72 RLQEKHGNKWKKIAAEVPGRTAKRLGKWW-EVFKEKQQREEKESNKRVEPIDESKYDRIL----- 130

  Fly   266 GISKCMNNMQHNKESGGEAVNKSEN----ADGASVTAV----KGGDLAQESQ 309
                         ||..|.:.|..:    |..|:.|.|    .||.|..|.|
plant   131 -------------ESFAEKLVKERSNVVPAAAAAATVVMANSNGGFLHSEQQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 3/7 (43%)
PLN03212 136..>236 CDD:178751 37/99 (37%)
Cmyb_C 388..>484 CDD:462753
AS1NP_181299.1 PLN03212 3..>122 CDD:178751 40/115 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.