DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB70

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_179910.1 Gene:MYB70 / 816861 AraportID:AT2G23290 Length:309 Species:Arabidopsis thaliana


Alignment Length:209 Identity:80/209 - (38%)
Similarity:110/209 - (52%) Gaps:42/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 IKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEII 199
            |||||:.:|||::..||:..||:.|:||::.:.||.||.||.||.|.|:|.::...:|.:||:.|
plant    12 IKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFTAEEDDTI 76

  Fly   200 YQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYD------VERRSVNASGSDLKSSRTHL 258
            ..||...||:||.||:.|.||||||||||||||::||..      .|.:|.:..|          
plant    77 ILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGGGEEGQSCDFGG---------- 131

  Fly   259 ITLIKSGGISKCMNNMQHNK-----ESGGEAVNKSENADGASVTAVK--GGDLAQESQDDHQKGS 316
                 :||..   .|:...|     .|||..|        ..|||:.  |.|::::||   ..||
plant   132 -----NGGYD---GNLTDEKPLKRRASGGGGV--------VVVTALSPTGSDVSEQSQ---SSGS 177

  Fly   317 NLAHLSMQHLIKLT 330
            .|...|..|:.|.|
plant   178 VLPVSSSCHVFKPT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 8/11 (73%)
SANT 136..184 CDD:197842 24/47 (51%)
Myb_DNA-bind_6 139..197 CDD:290632 24/57 (42%)
SANT 188..235 CDD:197842 27/46 (59%)
Myb_DNA-binding 188..233 CDD:278669 26/44 (59%)
Cmyb_C 388..530 CDD:286408
MYB70NP_179910.1 SANT 13..61 CDD:197842 24/47 (51%)
Myb_DNA-binding 13..59 CDD:278669 23/45 (51%)
SANT 68..112 CDD:197842 27/43 (63%)
Myb_DNA-binding 68..110 CDD:278669 26/41 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45614
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.