DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and AT2G13960

DIOPT Version :10

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_179013.2 Gene:AT2G13960 / 815880 AraportID:AT2G13960 Length:150 Species:Arabidopsis thaliana


Alignment Length:143 Identity:46/143 - (32%)
Similarity:68/143 - (47%) Gaps:23/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MNYGSN---SDSEESEYSENEDTQVCDKDSQ----QNSNADSG---YPLDSPELQDSKTTGQKGQ 67
            |:..||   ...|:.|.||.:....|.::.|    ..|:|..|   :.|.|||:....|.....:
plant     1 MSSSSNPPVCSPEKEERSEMKIEIQCMENKQPLAASCSSASEGSGCFFLKSPEIATPATVSSFPR 65

  Fly    68 NKSG--KTSIGAVHPNYGFGKRWSKSEDVLLKQLVETH-GENWEIIGPHFKDRLEQQVQQRWAKV 129
            ..||  :.:.|.          |:..||..|::.||.: |:.|:.|...|.:|.:.|...||.||
plant    66 RTSGPMRRAKGG----------WTPEEDETLRRAVEKYKGKRWKKIAEFFPERTQVQCLHRWQKV 120

  Fly   130 LNPELIKGPWTRD 142
            |||||:|||||::
plant   121 LNPELVKGPWTQE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 Myb_DNA-bind_6 88..147 CDD:372817 26/56 (46%)
PLN03212 136..>236 CDD:178751 5/7 (71%)
Cmyb_C 388..>484 CDD:462753
AT2G13960NP_179013.2 Myb_DNA-binding 75..121 CDD:459731 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.