DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and Ttf1

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:XP_006233944.1 Gene:Ttf1 / 499766 RGDID:1565673 Length:912 Species:Rattus norvegicus


Alignment Length:429 Identity:72/429 - (16%)
Similarity:137/429 - (31%) Gaps:139/429 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RWSKSEDVLLKQLVETHGENWEIIGPHFKDRLEQQVQQRWAKVLNPELIKGPWTRDEDDMVIKLV 151
            |:::.:...||.....||.:|:.||. ...|....|..::::: :.:...|.|::.|...:||.|
  Rat   618 RYNEEDTKKLKAYHSLHGNDWKKIGA-MVARSSLSVALKFSQI-DGDRNHGTWSKAETQRLIKAV 680

  Fly   152 RNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEI-IYQAHLELGNQWAKIAK 215
            .:...||.:          .::.||     |:..:::    :.|..: |.:..|..|..|.::..
  Rat   681 EDVILKKMS----------SQELRE-----LDSRLQE----DPEGRLSIVREKLYKGISWVEVEA 726

  Fly   216 RLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLIKSGGISKCMNNMQHNKES 280
            |:..|.....|:.|                          |.::|           ..|.|    
  Rat   727 RVETRNWMQCKSKW--------------------------TEILT-----------KRMTH---- 750

  Fly   281 GGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQHLIKLTMPRQTPIILKRTRKH 345
             |..|.:...|..|.:|.:                                              
  Rat   751 -GGFVYRGVKALQAKITLI---------------------------------------------- 768

  Fly   346 IPETHHQAGCSSSETFNQEEAAGNARSRPPSSPVISPIKSLPFSPSHF--LKSPCLTTFEDMDLR 408
              |..::...:.:...:.|:.||.....||           ||..:.|  ||:.|:..::.....
  Rat   769 --ERLYELNVNDANEIDWEDLAGAIGDVPP-----------PFVQAKFYKLKAACVPFWQKKTFP 820

  Fly   409 ASTPVTKVYNRVGMEIKKEMETSSIETPHKSQLGPRTPTPFKKALAAIGKKRDGRRYEPSSPSS- 472
            ....:.|....:.:|...:|...:........|...:....|:.||...||:|.:..:|::|.. 
  Rat   821 GVGIIIKALRPLTLEAYTDMSKMTFSVEIIDYLYENSLPLLKEKLAKKMKKKDSQIQKPTAPKQN 885

  Fly   473 -LVEDLAEIIHEEHLSNSLTANNSKMMGAADQNSTLSTE 510
             |.:|   |.|.:..|:.         |..::.||..|:
  Rat   886 FLFKD---IFHCDDDSDE---------GGLEEPSTSDTQ 912

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 10/44 (23%)
Myb_DNA-bind_6 88..147 CDD:290632 12/58 (21%)
SANT 136..184 CDD:197842 11/47 (23%)
Myb_DNA-bind_6 139..197 CDD:290632 11/57 (19%)
SANT 188..235 CDD:197842 9/47 (19%)
Myb_DNA-binding 188..233 CDD:278669 9/45 (20%)
Cmyb_C 388..530 CDD:286408 26/127 (20%)
Ttf1XP_006233944.1 Myb_DNA-bind_6 621..676 CDD:290632 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.