DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and ttf1.6

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:XP_005168698.1 Gene:ttf1.6 / 449954 ZFINID:ZDB-GENE-041008-214 Length:549 Species:Danio rerio


Alignment Length:322 Identity:68/322 - (21%)
Similarity:114/322 - (35%) Gaps:96/322 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ENGEELMNYGSNSDSEESEYSENED-----TQVCD-----------KDSQQNSNADSGYP----- 50
            :.|.|| .:|..|.:|.....:|..     |.|.|           |:||..:|....|.     
Zfish   205 KQGIEL-RHGRFSTAENERLRQNVSNFLALTGVKDAIKLFHPKRFPKESQTLANLKRKYSFFVKI 268

  Fly    51 ---LDSPELQDSKTTGQK---GQNKSGKTSIGAVHPNYGFGKRWSKSEDVLLKQLVETHGENWEI 109
               :..| ..|..|.|.|   .:||.|               .:::.|:..|.:....:|.:|:.
Zfish   269 AEGIPRP-CHDVYTRGTKIYDDRNKKG---------------NFTEEEEKSLLKYYTLYGPDWKK 317

  Fly   110 IGPHFKDRLEQQVQQRWAKVLNPELIKGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQC 174
            |... .||....:::|::.:   ..|:||||.:|...:::.||:.       :...|..      
Zfish   318 ISDK-TDRSSYSLEKRFSHL---SKIRGPWTTNEVQRLLRAVRDH-------VVSVLKS------ 365

  Fly   175 RERWHNHLNPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDV 239
                   .||..||.....:  ||:|||     ..|:|||:::..|.....::.|.|.:..:.. 
Zfish   366 -------ANPKKKKPKRVSR--EILYQA-----LPWSKIAEKVKTRCWTKCRDKWMSILASRMS- 415

  Fly   240 ERRSVNASGSDLKSSRTHLITLIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKG 301
              ..:...|...:.::..||         :.|..||         |....:.|...:|||.|
Zfish   416 --SGITFRGRKAQEAKIKLI---------RAMYEMQ---------VEDVVDVDWEHLTAVFG 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 8/46 (17%)
Myb_DNA-bind_6 88..147 CDD:290632 14/58 (24%)
SANT 136..184 CDD:197842 8/47 (17%)
Myb_DNA-bind_6 139..197 CDD:290632 10/57 (18%)
SANT 188..235 CDD:197842 13/46 (28%)
Myb_DNA-binding 188..233 CDD:278669 13/44 (30%)
Cmyb_C 388..530 CDD:286408
ttf1.6XP_005168698.1 Myb_DNA-bind_6 296..351 CDD:290632 14/58 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.