DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and Pbp95

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster


Alignment Length:466 Identity:96/466 - (20%)
Similarity:179/466 - (38%) Gaps:85/466 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RWSKSEDVLLKQLVETHGE----NWEIIGPHFKDRLEQQVQQRWAKVLNPELIKGPWTRDEDDMV 147
            |||:.::..|:.:|:.:..    ||:.:..:|.|:.:..:..|:..||:|.:...|:|..||.|:
  Fly   286 RWSEEDNDKLRAIVDRNTANSVINWKKVVEYFPDKSKSTLIGRYYYVLHPSISHEPFTTKEDMML 350

  Fly   148 IKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEIIYQAHLELG-NQWA 211
            ...|..:..|...........|...|.|.|:||.|....|..:|:.::|..:.....:.| :||.
  Fly   351 FAAVEEYNGKFHCFPRSLFPNRSLTQLRTRYHNVLAQRNKTDSWSVQDDTRLMSFVTQYGASQWL 415

  Fly   212 KIAKRLPGRTDNAIKNHWNSTMRRKYDVERR----SVNASGSDLKSSRTHLITLIKSGGISKCMN 272
            ..|        ..:.||..::.|.::.|.::    :.||...||...|:..::|:.|...::.:.
  Fly   416 NCA--------TFLGNHTRTSCRTRFLVIKKFLEQNPNAKVEDLPRRRSKKVSLVNSDNWAQRLQ 472

  Fly   273 NMQHNKESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQ--------HLIKL 329
            ..|.:.||   .||.:. ..|..|...|......|.|  .:..|.|:.:.::        :.:.|
  Fly   473 EWQEDPES---LVNDNP-PKGTRVRGPKSKKARIERQ--AESFSRLSKVDIEFCNFFKFSYNLTL 531

  Fly   330 TMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPSSPVISPIKSLPFSPSHFL 394
            :.|:..|:                   ..:.:|..........:||..|  |.:::: |.|:..|
  Fly   532 STPKTFPV-------------------PKDVYNLAYVIRALAYKPPIRP--SLLQNI-FMPNDVL 574

  Fly   395 KSPCLTTF------EDMDLRASTPVTKVYNRVGM--------EIKKEMETSSIETPHKSQLGPRT 445
            |  |..:.      |:.|:::..........:|.        :.:|:.||.|.|  :...|.|  
  Fly   575 K--CYNSMIRNLPDEEGDMKSPLLPPNWSTMMGFRALCILSGDCRKDTETRSFE--YNESLPP-- 633

  Fly   446 PTPFKKALAAIGKK-----RDGRRYEPSSPSSLV------EDLAEI-IHEEHLSNSLTANNSKMM 498
            ...|:|.|.|:..:     |...:.....||:||      .|.|:: .|.|.:.......|....
  Fly   634 IQLFRKRLQALFYRTTLLSRLESQLFTDLPSALVSLPRPKHDYAKMGTHVELIDPEPAPQNDLKS 698

  Fly   499 GAADQNSTLST 509
            ....:|..::|
  Fly   699 EPLSENEVINT 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 12/48 (25%)
Myb_DNA-bind_6 88..147 CDD:290632 16/62 (26%)
SANT 136..184 CDD:197842 14/47 (30%)
Myb_DNA-bind_6 139..197 CDD:290632 15/57 (26%)
SANT 188..235 CDD:197842 8/47 (17%)
Myb_DNA-binding 188..233 CDD:278669 8/45 (18%)
Cmyb_C 388..530 CDD:286408 31/148 (21%)
Pbp95NP_649760.1 DUF883 4..>74 CDD:295076
SANT <194..240 CDD:304392
SANT 229..276 CDD:197842
Myb_DNA-binding 229..275 CDD:278669
Myb_DNA-bind_6 287..350 CDD:290632 16/62 (26%)
SANT 392..438 CDD:197842 10/53 (19%)
Myb_DNA-binding 393..437 CDD:278669 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2047
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.