DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and rtf1

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_594730.2 Gene:rtf1 / 2541545 PomBaseID:SPAC22F8.07c Length:466 Species:Schizosaccharomyces pombe


Alignment Length:237 Identity:51/237 - (21%)
Similarity:97/237 - (40%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RWSKSEDVLLKQLVETHGENWEIIGPHFKDRLEQQVQQRWAKVLNP-ELIKGPWTRDEDDMVIKL 150
            :|:..::..||:|||.||.:|.:|| ...:||....:..|...:.| |:.:.|||..|.:.:||.
pombe   258 KWTIEDEAELKKLVEKHGTSWSLIG-KLSNRLPMHCRDHWRDYIQPGEINRSPWTIQEKEKLIKT 321

  Fly   151 VRNF------GPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTA--------W--------TE 193
            |..:      .|.:|:||::.:..|....||.:::..::.:|..::        |        ..
pombe   322 VNQYLQSNPSSPIQWSLISKNMRNRHRHHCRWKYYTLISRDIHNSSPFKLGDSIWLIERMMDLNV 386

  Fly   194 KEDEII-------YQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASG-SD 250
            .|:.:|       |..||     |          |.:|.|:|        ::..::::...| |.
pombe   387 AEERMIDWKCLSEYANHL-----W----------TADACKSH--------FERIKKTLFIDGLST 428

  Fly   251 LKSSRTHLITLIKSGGISKCMNNMQHNKESGGEAVNKSENAD 292
            ...:..||..::.|......::|:.       ::.....|||
pombe   429 FSDTLIHLHKMLNSSPEETYISNLH-------DSYTAFSNAD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 14/44 (32%)
Myb_DNA-bind_6 88..147 CDD:290632 20/59 (34%)
SANT 136..184 CDD:197842 14/53 (26%)
Myb_DNA-bind_6 139..197 CDD:290632 16/79 (20%)
SANT 188..235 CDD:197842 11/69 (16%)
Myb_DNA-binding 188..233 CDD:278669 11/67 (16%)
Cmyb_C 388..530 CDD:286408
rtf1NP_594730.2 REB1 1..466 CDD:227476 51/237 (22%)
Myb_DNA-bind_6 259..318 CDD:290632 20/59 (34%)
Myb_DNA-binding 307..359 CDD:278669 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100129
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2047
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.