DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and reb1

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001342963.1 Gene:reb1 / 2539930 PomBaseID:SPBC1198.11c Length:504 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:40/148 - (27%)
Similarity:66/148 - (44%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 WSKSEDVLLKQLVETHGENWEIIGPHFKDRLEQQVQQRWAKVL--NPELIKGPWTRDEDDMVIKL 150
            |||.||..|::.|..||:.|..||.... |:....:.||..|:  ..:|.:..|:.:|:..::::
pombe   316 WSKEEDEELRKNVVEHGKCWTKIGRKMA-RMPNDCRDRWRDVVRFGDKLKRNAWSLEEETQLLQI 379

  Fly   151 VRNFGPKK-------WTLIARYLNGRIGKQCRERWHNHLNP----NIKKTAWTEKEDEIIYQAHL 204
            |.....::       |||:|:.|..|...|||.::......    .:::..|..   |.||.:.|
pombe   380 VAELRNREDLSSDINWTLVAQMLGTRTRLQCRYKFQQLTKAASKFELQENVWLL---ERIYDSLL 441

  Fly   205 ELGNQ--WAKIAKRLPGR 220
            ..|.:  |..|.|...||
pombe   442 NNGGKIHWENIVKEANGR 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 16/45 (36%)
Myb_DNA-bind_6 88..147 CDD:290632 19/60 (32%)
SANT 136..184 CDD:197842 12/54 (22%)
Myb_DNA-bind_6 139..197 CDD:290632 13/68 (19%)
SANT 188..235 CDD:197842 11/35 (31%)
Myb_DNA-binding 188..233 CDD:278669 11/35 (31%)
Cmyb_C 388..530 CDD:286408
reb1NP_001342963.1 REB1 2..504 CDD:227476 40/148 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2047
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.