DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and Dmtf1l

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_808373.1 Gene:Dmtf1l / 237029 MGIID:3045322 Length:470 Species:Mus musculus


Alignment Length:275 Identity:66/275 - (24%)
Similarity:112/275 - (40%) Gaps:69/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KGQNKS--GKTSIGAVHPNYGFGKR-------------WSKSEDVLLKQLVETHGENWEIIGPHF 114
            ||:.|.  ...|:|...|.:...:|             :|..|...||:|.:.||.:|..||...
Mouse   166 KGKRKDFYRSVSLGLNRPLFSVYRRVVRMYDDRNHVGKYSPEEIEKLKELWQKHGNDWITIGAAM 230

  Fly   115 KDRLEQQVQQRWAKVLNPELIKGPWTRDED----DMVIKLVRNFGPKK------WTLIARYLNGR 169
             .|....|:.| .:::......|.||.:|:    |:|.:|......:|      |..:|:.:..|
Mouse   231 -GRSPSSVKDR-CRLMKDTCNTGKWTEEEEQLLGDVVHELTCTEVDEKVTHGVCWATVAQRVGTR 293

  Fly   170 IGKQCRERWHNHLNPNIKKTA---WTEKEDEIIYQAHLELG------NQWAKIAKRLPG-RTDNA 224
            ..||||.:|.|:|  |.|:|.   ||.|::..:.|..:||.      .:|.::||.... |:...
Mouse   294 SAKQCRAKWLNYL--NWKQTGGIEWTRKDEVTLIQRLVELDVSDESEIRWDELAKGWESVRSPQW 356

  Fly   225 IKNHW------------------NSTMRRKYDVERRSV----NASGSDLKSSRTHLI-------- 259
            ::|.|                  ...::::|:.:..|:    |.|||::..|...:|        
Mouse   357 LRNKWWIIKRQITNHKDFAFPVLVRCLQQEYESQNASLRFWENKSGSEVPDSNPDIIFQQVPFGV 421

  Fly   260 TLIKSGGISKCMNNM 274
            |.|::...|.|.:.|
Mouse   422 TSIENNNASICTDPM 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 14/59 (24%)
Myb_DNA-bind_6 88..147 CDD:290632 18/62 (29%)
SANT 136..184 CDD:197842 18/57 (32%)
Myb_DNA-bind_6 139..197 CDD:290632 23/70 (33%)
SANT 188..235 CDD:197842 13/74 (18%)
Myb_DNA-binding 188..233 CDD:278669 13/72 (18%)
Cmyb_C 388..530 CDD:286408
Dmtf1lNP_808373.1 SANT 202..247 CDD:197842 13/46 (28%)
Myb_DNA-bind_6 205..261 CDD:290632 17/57 (30%)
SANT 251..307 CDD:197842 18/57 (32%)
Myb_DNA-binding 251..306 CDD:278669 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2047
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.