DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and Ttf1

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:XP_036016405.1 Gene:Ttf1 / 22130 MGIID:105044 Length:867 Species:Mus musculus


Alignment Length:584 Identity:119/584 - (20%)
Similarity:198/584 - (33%) Gaps:187/584 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NSDSEESEYSENEDTQVCDKDSQQNSNADSGYPLDSPE--LQDSKTTGQKGQNKSGKTSIGAVHP 80
            ||:||:...::....:  .|.|||.:::    .|.:||  |:..|||   ..:|..|.|:..|..
Mouse   166 NSESEQPRKAKRRRKK--RKGSQQPTSS----LLKTPETFLKAKKTT---SAHKKKKNSVLEVDM 221

  Fly    81 NYGFGKRWSKSEDVL-----LKQLVETHGENWEIIGPHFKDRLEQQVQQRWAKVLNPELIKGPWT 140
            ..|.         :|     ::.|:||..::.:|:      .::....||.|||           
Mouse   222 ETGI---------ILVDKENMENLLETSRKDVDIV------YVDMSKGQRSAKV----------- 260

  Fly   141 RDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEIIYQAHLE 205
            |:..::.....:..|       .|.|.|.:..:.:::   ||.   |...|     :::.     
Mouse   261 RETGELPAAKPQEHG-------CRELLGDVRSRKKQK---HLQ---KVAPW-----DVVQ----- 302

  Fly   206 LGNQWAKI---------AKRLPGRTDNA---IKNHWNSTMRRKYDVERRSVNASGSDLKSSR--- 255
             |:|...|         ::.|.|::..|   .|......:.|..::|....:...|:..|.|   
Mouse   303 -GSQPESISLPPSEPLSSEDLEGKSTEAAVFCKKKSKKNVFRSQELEPIPDSLDDSETISERLDS 366

  Fly   256 THLITLIKSGGISKCMNNMQHNKESGG----------EAVNKSENADGASVTAVK---------- 300
            ||      .||........:..|||..          ::|..:.::|.||||..|          
Mouse   367 TH------HGGAVGAGEECESTKESHSIKKKSKKKKHKSVALATSSDSASVTDSKAKNALVDSSE 425

  Fly   301 GGDLAQESQDDHQKGSNLAHLSMQHLIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365
            |....:|...||:.....|........:..|.|..|            ||.:.  |:||:.:...
Mouse   426 GSGAVREEDVDHRPAEAEAQACSTEKHREAMQRLEP------------THEEE--SNSESASNSA 476

  Fly   366 AAGNARSRPPSS----PVISPIKSL-PFSPSHFLKSPCLTTFEDMDLRASTPVTKVYN------- 418
            |...:..|..|.    .:.|.::.| .|.|             |:..||:|.:.::|.       
Mouse   477 ARHISEDRRESDDSDVDLGSAVRQLREFIP-------------DIQERAATTIRRMYRDDLGRFK 528

  Fly   419 ---------RVGMEIKKE-----------METSSIETPHKSQLGPRTPTPFKKALAAIGKKRDGR 463
                     |.|....||           :..:.||:..|.....|.|.  :|.|....|::...
Mouse   529 EFKAQGVAIRFGKFSAKENKQIEKNVQDFLSLTGIESADKLLYTDRYPE--EKTLITNLKRKHAF 591

  Fly   464 RYE----PSSPSSLVEDLAEII----------HEEHLS-----NSLTANNSKMMGAADQNSTLS 508
            |..    .:.|..||...|:.|          :||...     :||..|:.|.:||....|:||
Mouse   592 RLHIGKGIARPWKLVYYRAKKIFDVNNYKGRYNEEDTKKLKAYHSLHGNDWKKIGAMVARSSLS 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 10/51 (20%)
Myb_DNA-bind_6 88..147 CDD:290632 11/63 (17%)
SANT 136..184 CDD:197842 7/47 (15%)
Myb_DNA-bind_6 139..197 CDD:290632 9/57 (16%)
SANT 188..235 CDD:197842 8/58 (14%)
Myb_DNA-binding 188..233 CDD:278669 8/56 (14%)
Cmyb_C 388..530 CDD:286408 36/167 (22%)
Ttf1XP_036016405.1 Myb_DNA-bind_6 625..680 CDD:372817 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.