DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBL3 and MUB1

DIOPT Version :9

Sequence 1:NP_001162763.1 Gene:UBL3 / 32541 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001319438.1 Gene:MUB1 / 821307 AraportID:AT3G01050 Length:117 Species:Arabidopsis thaliana


Alignment Length:103 Identity:22/103 - (21%)
Similarity:44/103 - (42%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 FSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGRFLHCNVTLGALGLPL----GKTTVM 312
            |..:.:...:.:||...||.:..:...:..|: :||..|:.|..:.|:.....|:    |..|.|
plant    25 FPDATTVSALKETVISEWPREKENGPKTVKEV-KLISAGKVLENSKTVKDYRSPVSNLAGAVTTM 88

  Fly   313 HLVPRDNLPEPNSQ---DQRQNSKGGSGRCCSTNCSIL 347
            |::.:..:.|...:   |.:.|      :|.   ||::
plant    89 HVIIQAPVTEKEKKPKGDPKMN------KCV---CSVM 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 20/95 (21%)
MUB1NP_001319438.1 Rad60-SLD_2 6..115 CDD:372780 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13169
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.