DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBL3 and ubl3b

DIOPT Version :9

Sequence 1:NP_001162763.1 Gene:UBL3 / 32541 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_998021.1 Gene:ubl3b / 405782 ZFINID:ZDB-GENE-040630-4 Length:117 Species:Danio rerio


Alignment Length:107 Identity:71/107 - (66%)
Similarity:81/107 - (75%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DKINLRLILVSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGRFLHCNVT 298
            |.:|||||||||||::|.|||:|||.|||:.||:|||..|..|:||...|||||:||||||.|||
Zfish     8 DTVNLRLILVSGKTQDFTFSPNDSATDIARHVFENWPAGWEEESVSSPSILRLIFQGRFLHGNVT 72

  Fly   299 LGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCC 340
            ||||.||.|:|||||||.|:.||||||..||...|.....||
Zfish    73 LGALKLPPGRTTVMHLVARETLPEPNSHGQRNREKTTESSCC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 71/107 (66%)
ubl3bNP_998021.1 Rad60-SLD_2 8..114 CDD:290592 69/105 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3955
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006329
OrthoInspector 1 1.000 - - otm26285
orthoMCL 1 0.900 - - OOG6_104537
Panther 1 1.100 - - O PTHR13169
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4050
SonicParanoid 1 1.000 - - X4605
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.