DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBL3 and ubl3a

DIOPT Version :9

Sequence 1:NP_001162763.1 Gene:UBL3 / 32541 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_997851.1 Gene:ubl3a / 324710 ZFINID:ZDB-GENE-030131-3431 Length:117 Species:Danio rerio


Alignment Length:114 Identity:81/114 - (71%)
Similarity:87/114 - (76%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 MHRTIPSDKINLRLILVSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGR 291
            |...||.|.|||||||||||||||:|||:|||.|||:.|:||||.||..|.||...|:|||||||
Zfish     1 MTGNIPVDMINLRLILVSGKTKEFLFSPNDSAADIAKHVYDNWPMDWEEEQVSSPNIVRLIYQGR 65

  Fly   292 FLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCC 340
            |||.|||||.|.||||||||||||.|:.|||||||.||...|.|...||
Zfish    66 FLHGNVTLGVLKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 78/107 (73%)
ubl3aNP_997851.1 Rad60-SLD_2 8..114 CDD:290592 76/105 (72%)
UBQ 10..88 CDD:214563 60/77 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3955
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5153
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006329
OrthoInspector 1 1.000 - - otm26285
orthoMCL 1 0.900 - - OOG6_104537
Panther 1 1.100 - - LDO PTHR13169
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4050
SonicParanoid 1 1.000 - - X4605
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.