DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBL3 and C46F11.6

DIOPT Version :9

Sequence 1:NP_001162763.1 Gene:UBL3 / 32541 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001021222.1 Gene:C46F11.6 / 259497 WormBaseID:WBGene00008121 Length:121 Species:Caenorhabditis elegans


Alignment Length:108 Identity:62/108 - (57%)
Similarity:76/108 - (70%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 SDKINLRLILVSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGRFLHCNV 297
            ::::.||||||||||.||.|.|..||.|:.|.|||.||::|..:.|..|::|:|||.|||||.:|
 Worm    11 AERVVLRLILVSGKTHEFEFHPLTSAHDVTQMVFDQWPDEWYEDKVQSAQMLKLIYHGRFLHGSV 75

  Fly   298 TLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCC 340
            ||.||.|..|||||||||.|:|||||||.:.....|  |..||
 Worm    76 TLHALQLMPGKTTVMHLVTRENLPEPNSSETLTKRK--SAGCC 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 62/107 (58%)
C46F11.6NP_001021222.1 Rad60-SLD_2 12..118 CDD:290592 62/107 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I3486
eggNOG 1 0.900 - - E1_2A8K3
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5153
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006329
OrthoInspector 1 1.000 - - oto18017
orthoMCL 1 0.900 - - OOG6_104537
Panther 1 1.100 - - LDO PTHR13169
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4050
SonicParanoid 1 1.000 - - X4605
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.