DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBL3 and ubl3

DIOPT Version :9

Sequence 1:NP_001162763.1 Gene:UBL3 / 32541 FlyBaseID:FBgn0026076 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001107740.1 Gene:ubl3 / 100135746 XenbaseID:XB-GENE-951598 Length:117 Species:Xenopus tropicalis


Alignment Length:114 Identity:81/114 - (71%)
Similarity:90/114 - (78%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 MHRTIPSDKINLRLILVSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGR 291
            |..::|:|.|||||||||||||||::||:|||.|||:.|:||||.||..|.||...|||||||||
 Frog     1 MSSSVPADMINLRLILVSGKTKEFLYSPNDSAADIAKHVYDNWPMDWEEEQVSSPNILRLIYQGR 65

  Fly   292 FLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCC 340
            |||.|||||||.||||||||||||.|:.|||||||.||...|.|...||
 Frog    66 FLHGNVTLGALKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBL3NP_001162763.1 Rad60-SLD_2 234..341 CDD:290592 79/107 (74%)
ubl3NP_001107740.1 Ubl_UBL3 10..91 CDD:340568 64/80 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6672
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5153
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006329
OrthoInspector 1 1.000 - - oto105585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4605
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.